Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "abutan"

1. Hindi ako maaring abutan ng hatinggabi, kapag hindi ako umalis ngayon ay hindi na ako makakabalik pa sa amin.

Random Sentences

1. It takes strength and courage to offer forgiveness, especially when the hurt is deep.

2. Hindi ako komportable sa kanilang plano kaya ako ay tumututol.

3. She admires the philanthropy work of the famous billionaire.

4. Nakapag-simula ako ng halinghing exercise nang hindi inaasahan na makakatulong ito sa aking anxiety.

5. Helte findes i alle samfund.

6. Más vale tarde que nunca.

7. Magaling sumayaw ng Tinikling si Gabe.

8. Many churches hold special Christmas services, such as midnight Mass, to celebrate the birth of Jesus and share the message of love and compassion.

9. Tuwang-tuwa pa siyang humalakhak.

10. Nosotros celebramos la Navidad con toda la familia reunida.

11. The restaurant didn't have any vegetarian options, and therefore we had to go somewhere else to eat.

12. Ang pagmamalabis sa pag-inom ng alak ay maaaring magdulot ng mga problemang pangkalusugan at personal.

13. Puwede akong tumulong kay Mario.

14. Las redes sociales también son un medio para hacer negocios y promocionar productos.

15. Las hierbas medicinales se utilizan desde hace siglos para tratar diversas dolencias.

16. Wag kana magselos, mahal naman kita eh.

17. Sa pagsasaayos ng aming barangay hall, nagkaroon kami ng malaking tagumpay dahil sa bayanihan ng mga residente.

18. Microscopes can be used to study living organisms in real-time, allowing researchers to observe biological processes as they occur.

19. Athena.. malapit na tayo.. konting tiis na lang..

20. Some Christians participate in fasting, prayer, and other spiritual practices during Holy Week as a way of deepening their faith and connection to God.

21. Les étudiants peuvent obtenir des diplômes dans une variété de domaines d'études.

22. Bumili si Pedro ng bagong bola para sa kanilang basketball game.

23. Sinimulan ko ng basahin sa entry kung saan nakabuklat.

24. Marahil ay hindi mo muna dapat gamitin ang pera mo sa pagbili ng bagong gadget.

25. Ang kabanata ay nagtapos sa isang maigting na eksena o cliffhanger, na nagtulak sa mga mambabasa na magpatuloy sa pagbasa.

26. Sa loob ng sinehan, nabigla siya sa biglang pagsabog ng surround sound system.

27. Sweetness can be enhanced with spices, such as cinnamon and nutmeg.

28. Kasama ang katipunan, Matapang na pinunit nina Andres Bonifacio ang cedula bilang protesta sa mga espanyol.

29. If you're expecting a quick solution to a complex problem, you're barking up the wrong tree.

30. Naging bahagi siya ng agaw-buhay na rescue mission upang iligtas ang mga tao sa panganib.

31. Las hojas de eucalipto se utilizan a menudo para aliviar la congestión nasal.

32. Unti-unting lumapad yung ngiti niya.

33. Cryptocurrency is a digital or virtual currency that uses cryptography to secure and verify transactions.

34. Sa bawat pagkakamali, mayroong aral na pwedeng matutunan, samakatuwid.

35. Mathematics is a language used to describe and solve complex problems.

36. Nakita niya ata ako kaya tinigil niya yung pagsasalita niya.

37. Omelettes are a popular choice for those following a low-carb or high-protein diet.

38. Les enseignants peuvent utiliser diverses méthodes pédagogiques pour faciliter l'apprentissage des élèves.

39. Tesla is an American electric vehicle and clean energy company.

40. Make use of writing software and tools, they can help you to organize your thoughts and improve your writing

41. Inalis ko yung pagkakayakap niya sa akin. At umupo sa sofa.

42. Ngumiti muna siya sa akin saka sumagot.

43. How I wonder what you are.

44. It's time to pull yourself together and start making positive changes in your life.

45. Kapitbahay ni Armael si Juang malilimutin.

46. Will Smith is a versatile actor and rapper known for his roles in films like "Men in Black" and "The Pursuit of Happyness."

47. Transkønnede personer har forskellige oplevelser af deres kønsidentitet og kan have forskellige præferencer og behov.

48. Smoking can be addictive due to the nicotine content in tobacco products.

49. Some sweet foods have cultural and religious significance, such as honey in Jewish traditions and dates in Muslim traditions.

50. Las personas pobres a menudo tienen que trabajar en condiciones peligrosas y sin protección laboral.

Similar Words

inaabutannaabutanmaabutaninabutan

Recent Searches

bayangabutanisipanvelfungerendecandidateslaruannagkalatiyakkargangmalapitanmatamanapologeticcareerinventadoracialwednesdaydiseaseanghelbisikletahahanapinmariainiintaysacrificebinanggapublishing,nyanhagdancarloproducts:ganidnatinsalitangtupelobigyannicogodtkinsefilmsyatanasanhappenedstruggledkinaintiningnanautomationninabisigtanimsinipangmesangduonsinunodcompostelameaningprincenakasuotokaylutomorenakubyertosbutihingmulimanuelpededitocadenareservedyanconvertidasprovejackyamonghumanosanimoangelafirstsyncstringstatesamaskillpersistent,inilingdentherefore4thkingbridemarahilnapadpadpresentamemorialkapangyarihanpagpapakilalatonightnakapilangalbularyolikuranpatientpangnangemailvisualpakilagaylawaymatapangbeyondnaglabalayuninbopolsnagbabagabusyangdrayberpiyanokatawankisamenilinispookanieasierpartiyonumanohumahabakumaenlibromabutipakelamerobalik-tanawcrazynabalitaanmahinaibinubulongdevelopngunitnasunogglobalisasyonprofessionalmalilimutinbilaonakakatulongpagka-maktolpoliticalkanya-kanyangadvertisingpinalambotsigurobibilhinakmangnatitirangnamilipiteksport,kilayitinaasmariloujennyeksportengreatlytililayuanpakainine-commerce,cashlaamangkinagalitannakakabangonmagkaparehoikinalulungkotnapakahusaykwenta-kwentapulang-pulapagkamanghamagpaniwalaganapsumusunodikinasasabiknanlilimahidkinikitamanamis-namismaglalakadnakaluhodlumalangoyspiritualkumakalansingnagtatampopinakamatapatsalamangkeronagmungkahipinagpatuloybumisitanakuhangtiniradorlumiwagpamahalaanmahawaannakapaligidpamanhikanselebrasyonmakasilongnegro-slavesmagsi-skiing