Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

13 sentences found for "seen"

1. A couple of lovebirds were seen walking hand-in-hand in the park.

2. God is often seen as the creator of the universe, with the power to influence and control natural phenomena and human destiny.

3. Have we seen this movie before?

4. Her decision to sponsor a child’s education was seen as a charitable act.

5. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

6. Hun er en af ​​de smukkeste kvinder, jeg nogensinde har set. (She is one of the most beautiful women I have ever seen.)

7. I have seen that movie before.

8. In some cultures, the role of a wife is seen as subservient to her husband, but this is increasingly changing in modern times.

9. Starting a business during an economic downturn is often seen as risky.

10. The team's games are highly anticipated events, with celebrities often seen courtside, adding to the glamour and excitement of Lakers basketball.

11. They have seen the Northern Lights.

12. Viruses can have a significant impact on global economies and healthcare systems, as seen with the COVID-19 pandemic.

13. We have seen the Grand Canyon.

Random Sentences

1. The patient was referred to a specialist in leukemia treatment for further evaluation and care.

2. He was hospitalized for pneumonia and was on a ventilator for several days.

3. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

4. Tantangan hidup juga dapat mengajarkan kita tentang nilai-nilai seperti kesabaran, rasa syukur, dan ketekunan.

5. The company's growth strategy is focused on acquiring more assets.

6. Landet har en omfattende social sikkerhedsnet, der sikrer, at alle borgere har adgang til sundhedspleje, uddannelse og sociale ydelser

7. Ang talambuhay ni Leandro Locsin ay nagpapakita ng kanyang husay at kontribusyon sa arkitektura ng Pilipinas.

8. Bruce Lee was a martial artist, actor, and philosopher who is widely considered to be one of the most influential figures in the history of martial arts

9. Mathematics can be used to model real-world situations and make predictions.

10. Iyon ang totoo, sinasabi niya sa sarili.

11. Kami ay umalis ng kaharian para ipagamot si Helena.

12. Kobe Bryant was known for his incredible scoring ability and fierce competitiveness.

13. Malapit lang pala bahay niyo eh. akala ko naman malayo!

14. Illegal drug traffic across the border has been a major concern for law enforcement.

15. Pero salamat na rin at nagtagpo.

16. Bitcoin is the first and most well-known cryptocurrency.

17.

18. Mahal ang mga bilihin sa Singapore.

19. Waring hindi pa tapos ang laban, kaya hindi kami dapat magpabaya.

20. Akin na cellphone mo. paguutos nya.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Indonesia dikenal dengan pantai-pantainya yang indah dan airnya yang jernih, seperti Bali, Lombok, dan Gili Islands.

23.

24. Sa pagtulong-tulong ng mga taga-komunidad, nagkaroon kami ng mas maayos na sistema ng basura.

25. Les systèmes de recommandation d'intelligence artificielle peuvent aider à recommander des produits et des services aux clients.

26. The uncertainty of the job market has led to many people rethinking their career paths.

27. Los blogs y los vlogs son una forma popular de compartir información en línea.

28. Las heridas por quemaduras pueden necesitar de tratamientos específicos, como el uso de cremas o apósitos especiales.

29. Helte kan have en positiv indflydelse på hele samfundet.

30. Pagtataka ko kung bakit hindi mo pa rin napapansin ang aking mga ginagawa para sa iyo.

31. Ayan sasamahan ka na daw ni Kenji.

32. The cough syrup helped to alleviate the symptoms of pneumonia.

33. El nacimiento de un hijo cambia la dinámica familiar y crea un lazo fuerte entre los miembros.

34. The invention of the telephone can be traced back to Alexander Graham Bell, who is credited with patenting the first practical telephone in 1876

35. Mahalagang mabigyan ng sapat na konsiderasyon ang mga isyu ng sektor ng anak-pawis sa pagpapasya ng mga polisiya ng pamahalaan.

36. Einstein's intellectual curiosity, creativity, and persistence in the face of challenges serve as a model for aspiring scientists and scholars.

37. And she said yes? parang nag-aalangan kong tanong.

38.

39. The business started to gain momentum after a successful marketing campaign.

40. Cultivar maíz es un proceso muy gratificante, ya que el maíz es una de las principales cosechas en todo el mundo

41. Pagkatapos ng misa, nagbigay ang pari ng mga panalangin para sa mga kaluluwa sa purgatoryo.

42. Emphasis can also be used to create a sense of urgency or importance.

43. The forensic evidence was used to convict the culprit in the arson case.

44. May iba pang sinasabi ang kanyang ina ngunit hindi na niya pinakinggan.

45. Malakas ang narinig niyang tawanan.

46. He will always be remembered as a legend who brought martial arts to the mainstream and changed the way the world looked at martial arts forever

47. Ipinakita ng albularyo ang kanyang halamang gamot na ginagamit niya sa pagpapagaling.

48. At have en træningsmakker eller træningsgruppe kan hjælpe med at øge motivationen og fastholde en regelmæssig træningsrutine.

49. Kung walang tiyaga, walang nilaga.

50. The backpacker's gear was hefty, but necessary for their long trek through the wilderness.

Recent Searches

callpreviouslyyelorelativelyseennagtaaskinikilalangvasqueseducationalipapainitateiospakpakpsychekasinggandawifinakangisibranchesmainitbumabadoingtumawagnagsamamalezaitoyoutube,hatinggabinakaluhodpamansinabingkutsaritangobra-maestragrewjulietpulispumayagsimbahainalokabalangnapakagandangcountlesspinagsikapanpakisabimatsinglahatmagalitnaggingpagpapasanmauntognapapalibutanoktubremagbibiyahepanghabambuhaycampaignsmapincludepag-akyatmgaincreasesreturnednapakasipagnapakabagalhellofrogpuwedeninyongestablishednasabingworkingapolloinvolvefertilizerbringingsofaipongmagbubungaproductiontoothbrushtumigilstreetasosimbahanbingopalantandaanboyetkaarawan,nakaindresspagluluksasundalonamumulapakinabangandangerousbentangtusongsyakambingfeelingrightpatakbotaga-suportadispositivomagulayawdapit-haponnaismanilbihanartistsugatfaultkaringiginawadkayabanganhumahabaprivateforskel,kinatatakutanmusiciansakimnagdiretsodespuescorporationskyldes,fulfillmentbestnagwikanghitarailsteamshipskinapatunayanyayahinahangaankabosesmakakuhasulatvalleyreallykinasisindakanmaintindihankatiepumatolcouldbecametumakboprocesolumulusobdatungipagbilitarangkahan,mahigitcrazydeathmagsasalitafonosinisihalalannakauslinginilalabaskaninonagmakaawamanirahanclasespinabulaanbobotocuandonagdabogpag-uugaliellenkendttiisbuhokcornernatuwana-curious1970snagbasataasbuhayentrebinigyangnamumuongborntulunganfionapagsasalitauriparisukatsoccercameraranayguidancetargettemparaturaprobablementefactorestanyaglimasawatekstmaulitdeja