Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

13 sentences found for "seen"

1. A couple of lovebirds were seen walking hand-in-hand in the park.

2. God is often seen as the creator of the universe, with the power to influence and control natural phenomena and human destiny.

3. Have we seen this movie before?

4. Her decision to sponsor a child’s education was seen as a charitable act.

5. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

6. Hun er en af ​​de smukkeste kvinder, jeg nogensinde har set. (She is one of the most beautiful women I have ever seen.)

7. I have seen that movie before.

8. In some cultures, the role of a wife is seen as subservient to her husband, but this is increasingly changing in modern times.

9. Starting a business during an economic downturn is often seen as risky.

10. The team's games are highly anticipated events, with celebrities often seen courtside, adding to the glamour and excitement of Lakers basketball.

11. They have seen the Northern Lights.

12. Viruses can have a significant impact on global economies and healthcare systems, as seen with the COVID-19 pandemic.

13. We have seen the Grand Canyon.

Random Sentences

1. Chumochos ka! Iba na pag inlove nageenglish na!

2. Omelettes are a popular choice for those following a low-carb or high-protein diet.

3. Dali na, ako naman magbabayad eh.

4. It's time to pull yourself together and start taking responsibility for your actions.

5. Additionally, be aware that not all opportunities on the internet are legitimate, so always do your own research before investing time or money into any opportunity

6. Adik na ako sa larong mobile legends.

7. Iyon hong hinog na mangga. Magkano ho?

8. Hinayaan ko siyang tulala sa kanyang pag-iisip bago ko siya kausapin.

9. Hvert fødsel er unik og kan have forskellige udfordringer og glæder.

10. The company lost a lot of money by cutting corners on product quality.

11. Kahit saang parte ng mundo ay may makikita ka pa ring gumagamit ng illegal na droga.

12. Kailan at saan po kayo ipinanganak?

13. Limitations can be addressed through education, advocacy, and policy changes.

14. Meskipun tantangan hidup tidak selalu mudah, mereka memberikan kesempatan untuk menjadi versi yang lebih baik dan lebih kuat dari diri kita sendiri.

15. **You've got one text message**

16. Anong nangyari sa iyo? Bakit ang tagal mong nawala?

17. You're not being direct. Stop beating around the bush and just say it.

18. Matagumpay na nagwagi si Wesley laban sa kasalukuyang kampeon ng boxing.

19. Have we completed the project on time?

20. Inakalang wala nang pag-asa, pero may dumating na tulong.

21. Sa ilalim ng malaking puno, natagpuan namin ang lilim na nagbibigay ginhawa mula sa init ng araw.

22. Ang gusali sa tabi ay mababa kumpara sa bagong itinayong opisina.

23. Ang paglapastangan sa ating mga tradisyon at kultura ay isang pagkawala ng ating pagkakakilanlan.

24. She has collaborated with several prominent artists, including The Weeknd, Nicki Minaj, and Lady Gaga.

25. Naglalaway ako sa amoy ng niluluto mong adobo.

26. Kapag may mga hindi malinaw na balita tungkol sa kalagayan ng kalusugan, maaaring magdulot ito ng agam-agam sa mga tao.

27. Las plantas suculentas son conocidas por su capacidad para almacenar agua en sus tejidos.

28. Bago matulog, naglalaba ako ng aking uniporme para sa darating na school week.

29. Hindi niya gustong maging nag-iisa sa buhay.

30. I wasn't supposed to tell anyone about the surprise party, but I accidentally let the cat out of the bag to the guest of honor.

31. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

32. Nasa likuran lamang niya ang nagsalita.

33. Las escuelas ofrecen diferentes planes de estudios, dependiendo del nivel y la especialización.

34. La conciencia nos ayuda a entender el impacto de nuestras decisiones en los demás y en el mundo.

35. Bunga ng globalisasyon ang pag-unlad ng maraming industriya sa iba't-ibang bansa.

36. Tuwing may sakuna, nagkakaisa ang mga Pinoy sa pagtulong sa kapwa.

37. Sa aking silid-tulugan, natatanaw ko ang ganda ng buwan na sumisilay sa bintana.

38. Ano ang sasayawin ng mga bata?

39. The clothing store has a variety of styles available, from casual to formal.

40. Ehrlich währt am längsten.

41. Si Bereti ay mula sa angkan na may maalwang buhay.

42. Sa takipsilim kami nagsimulang mag-akyat ng bundok.

43. "Ang pera ang ugat ng lahat ng kasamaan" ay isang bukambibig na nagsasabing ang pagkakaroon ng pera ang dahilan ng iba't ibang problema sa mundo.

44. Masdan mo ang aking mata.

45. Cancer can be diagnosed through medical tests, such as biopsies, blood tests, and imaging scans.

46. The acquired assets were key to the company's diversification strategy.

47. Dogs can provide a sense of security and protection to their owners.

48. Ano ang ginagawa mo nang nagkasunog?

49. The website's content is engaging and informative, making it a great resource for users.

50. Ibinigay ko sa kanya ang pagkakataon na magpakilala sa kanyang mga kaisa-isa.

Recent Searches

seendoonstoretuwidoverviewinformationobstaclestextokumarimotunoinislinelaylaybasketbolmahiyaomkringableefficientclienteinsteadseparationbetabroadcastingconsiderneverhellohapdisafe1982includingventanageenglishboxemocionalconstitutionsaanglagaslasnag-aalaytablemisyunerongprimeraslalabashabitandresniyonpaparamithemmeetcommunicationlikejobsiglokarapatangtanawgasmenshadeskaraokebaronglumbaynabigaybanalmusicalpaglayasunconstitutionalnagulatnapaplastikannapakatalinomagkikitapagkakatuwaanpagsasalitakumembut-kembotkasamakapalrefnalalabikumakapalnakahigangnakalagaysimbahannaglipanangkinapanayamnagre-reviewnagsilabasannalalaglagmangkukulamhinimas-himasaktibistapagtangisna-suwayeconomybloggers,nakapaligidlabing-siyammaliksipinagsikapantipidsasakyanmagsugaltutungoincluirmasasayanagbantaynagkalapitleadersmedicinepakakatandaantumamacompaniesinterests,taga-ochandoprincipalestahimikmamalaspagsubokdistanciamakapalkatolikohiramsandwichsarisaringlumiitnakariniglabisdecreasedkastilangtog,magbigayculturalmakalawasumpainnapakoimbesbiyasinintaypersonnilalangmerchandisepaggawabarangayalmacenarkuyapusakulotsusiayawculpritracialsyangupuanalakbagkuskamaodiscoveredlarobiliipinasyangayokobalanghopepanindangriyanrestaurantmagigitingjokeheargatheringibonomgorugalalatresmapaibabawsumayamrscharmingitinaliellamamioutlinesdaysmayocommissionitakfakewordssinasabilucytelevisednakaraanlcdaidclearmobileeksaytedbaketgamesumalascheduleellensaging