Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

13 sentences found for "seen"

1. A couple of lovebirds were seen walking hand-in-hand in the park.

2. God is often seen as the creator of the universe, with the power to influence and control natural phenomena and human destiny.

3. Have we seen this movie before?

4. Her decision to sponsor a child’s education was seen as a charitable act.

5. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

6. Hun er en af ​​de smukkeste kvinder, jeg nogensinde har set. (She is one of the most beautiful women I have ever seen.)

7. I have seen that movie before.

8. In some cultures, the role of a wife is seen as subservient to her husband, but this is increasingly changing in modern times.

9. Starting a business during an economic downturn is often seen as risky.

10. The team's games are highly anticipated events, with celebrities often seen courtside, adding to the glamour and excitement of Lakers basketball.

11. They have seen the Northern Lights.

12. Viruses can have a significant impact on global economies and healthcare systems, as seen with the COVID-19 pandemic.

13. We have seen the Grand Canyon.

Random Sentences

1. Kapag wala akong iniisip na problema, ako'y nakakaranas ng isang matiwasay na pagkakasundo sa aking sarili.

2. Sa gitna ng kaguluhan, hindi niya mapigilang maging tulala.

3. Nakakapagtaka naman na hindi nya ito nakita.

4. James Buchanan, the fifteenth president of the United States, served from 1857 to 1861 and was in office during the secession of several southern states.

5. Like a diamond in the sky.

6. Sabi mo eh! Sige balik na ako dun.

7. Ilalagay ko 'to sa mga action figure na collections ko.

8. My mom always bakes me a cake for my birthday.

9. Napilitan silang magtipid ng tubig dahil sa patuloy na tagtuyot.

10. Cancer can have physical symptoms, such as pain, fatigue, and weight loss, as well as emotional symptoms, such as anxiety and depression.

11. Kailangan ng mas magandang oportunidad sa trabaho at edukasyon para sa sektor ng anak-pawis.

12. Nagtatanim siya ng mga gulay at nanghuhuli ng mga hayop sa gubat upang kanilang pagkain

13. Taman Mini Indonesia Indah di Jakarta adalah tempat wisata yang menampilkan miniatur kebudayaan Indonesia dari 33 provinsi.

14. Bibigyan ko ng cake si Roselle.

15. Mapayapa ang kanilang lungsod sa pamumuno ng kanilang butihing Mayor.

16. The impact of the pandemic on mental health has been immeasurable.

17. Elektroniske apparater kan tilpasses til individuelle behov og præferencer.

18. Sumapit ang isang matinding tagtuyot sa lugar.

19. The stock market gained momentum after the announcement of the new product.

20. Uncertainty about the outcome of the election has caused tension in the community.

21. Green Lantern wields a power ring that allows him to create energy constructs based on his imagination.

22. Some sweet foods have cultural and religious significance, such as honey in Jewish traditions and dates in Muslim traditions.

23. Sapatos ang gustong sukatin ni Elena.

24. Los invernaderos permiten el cultivo de plantas en condiciones controladas durante todo el año.

25. She studies hard for her exams.

26. Ibinigay ko sa kanya ang pagkakataon na magpakilala sa kanyang mga kaisa-isa.

27. Nationalism can be a source of conflict between different groups within a nation-state.

28. Omelettes are a popular choice for those following a low-carb or high-protein diet.

29. Le stress et l'anxiété peuvent également avoir un impact négatif sur la motivation.

30. Pedeng ako na lang magsubo sa sarili ko?

31. Hinintay kong magsalita si Kuya Patrick sa kabilang linya.

32. Si Pedro ay namamanhikan na sa pamilya ni Maria upang hingin ang kanilang pahintulot na magpakasal.

33. Elektronisk udstyr kan hjælpe med at forbedre effektiviteten og produktiviteten af ​​virksomheder.

34. Sa naglalatang na poot.

35. A microscope is a device that uses lenses to magnify small objects.

36. Natuto siyang lumaban sa kaniyang mga magulang.

37. Masakit ba?? Tumingin siya sa akin, Masakit na naman ba??!!

38. Las aplicaciones móviles permiten el acceso a internet desde cualquier lugar.

39. Doa juga dapat dijadikan sarana untuk memohon perlindungan dan keberkahan dari Tuhan.

40. Nous avons eu une danse de mariage mémorable.

41. Eh what's the big deal ba? Parang kasama lang kahapon eh.

42. Many people think they can write a book, but good writers are not a dime a dozen.

43. Sus gritos están llamando la atención de todos.

44. Nais nating makamit ang ating mga pangarap upang magkaroon tayo ng mas magandang buhay.

45. Masyado akong matalino para kay Kenji.

46. They are a member of the National Basketball Association (NBA) and play in the Western Conference's Pacific Division.

47. Make use of writing software and tools, they can help you to organize your thoughts and improve your writing

48. Some viruses, such as the common cold and flu, can cause mild symptoms, while others, like HIV and Ebola, can be deadly.

49. The website's contact page has a form that users can fill out to get in touch with the team.

50. La science environnementale étudie les effets de l'activité humaine sur l'environnement.

Recent Searches

baldebinabachecksipapahingaseendollardinaladanceelectronicipapainitbadlcdclearfurthertipostipiddevicesenforcingfeelingeksaytedtargetaddhelpfulfuncionarmorepartnerresultidea:sedentarycomunesaddresssumapitattackdevelopmentprogramsevolveinformedyeahinteractlearningprogramming,withoutroughmitigatefutureberkeleyedit:makesreadtoolconsiderpackagingryanbetacrazyventauponeachimpactedreleasedrepresentednotebookincreasedparatingtalepinatutunayanpapuntapdaauthorkolehiyovidenskabtigasgandabrindardoktorbabesisinalangnagpaiyakfollowing,nageespadahanpointmahinanagagamitpagkasabiinaabotnatabunanproducererniyogbirthdaydescargarobservation,gasmendisciplin1960stawanantalagaenergiiniibigtoypuwedeplasahinogtracknakakatawascientistmapadalirhythmochandoelectedallowshighestmawalaclassesmaptablefalldenpollutionplaysfindngpuntailanprivateoutcondopangulonaritoespadadaanitinalicomplicatedresearchkitangipinikitpowermurangcafeterialabingloriroboticsumugodglobalfrachoiceflexiblenakakatulonggabi-gabinakapagreklamoadvertising,ikinabubuhaynagagandahanpagluluksamagkikitadistansyapagkakatayonagsusulatnanghahapdipinakamahalagangnakaliliyongmakalaglag-pantykikitanagtuturokalayaanmeriendanapaluhavirksomhederpagkakalutomagasawangpagngitipaga-alalahinipan-hipanmerlindaisinulatmagpaniwalagayunmanpangungutyaanibersaryopinapakiramdamanmaglalakadsalamangkerotinulak-tulakmagpa-checkupnamumuongnakagalawhumalakhaknaguguluhanpagkagustonalugmokmangkukulamkumikilospagpanhiknegro-slavesnaiyaknagreklamoentrancepaghihingalomakidalomagpakasalmakasilongiwinasiwas