Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "roselle"

1. Bibigyan ko ng cake si Roselle.

Random Sentences

1. Inflation kann die Preise von Vermögenswerten wie Immobilien und Aktien beeinflussen.

2. His life and career have left an enduring legacy that continues to inspire and guide martial artists of all styles, and his films continue to be popular today

3. Huwag mo nang papansinin.

4. If you think he'll lend you money, you're barking up the wrong tree.

5. Emphasis is the act of placing greater importance or focus on something.

6. Kahit hindi ako nagpapakita ng kilos, crush kita pa rin sa loob ng puso ko.

7. The beach has a variety of water sports available, from surfing to kayaking.

8. Umupo sa harapan ng klase ang mga mag-aaral nang limahan.

9. Bitawan mo nga ako, kakainin ko 'to.

10. Napilitan siyang bumangon at naghanda ng pagkain.

11. Repeated frustration can lead to feelings of hopelessness or helplessness.

12. Isang araw, sa kanyang pagluluto hindi niya makita ang posporo.

13. Nang malaman ko ang balitang malungkot, hindi ko mapigilang maglabas ng malalim na himutok.

14. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

15. Aku merindukanmu, sayang. (I miss you, dear.)

16. Ano namang naiisip mo? tanong ko sa mapag-asang tono.

17. Chris Paul is a skilled playmaker and has consistently been one of the best point guards in the league.

18. Over the years, television technology has evolved and improved, and today, there are a variety of different types of television sets available, including LCD, LED, and plasma TVs

19. The treatment for leukemia typically involves chemotherapy and sometimes radiation therapy or stem cell transplant.

20. In the last three hundred years, many human efforts have been spent in search of sources of energy-coal, petroleum, and power generated from water which will maintain the present rhythm of civilization unchecked

21. Mukha namang pangkaraniwan lang ang matanda at baka nga hindi pa nito alam kung paano humabi.

22. Ang aking kabiyak ay ang aking katuwang sa buhay, nagbibigay ng tulong at suporta sa bawat yugto ng aming paglalakbay.

23. Puwede ba kitang ibili ng inumin?

24. Napakaganda ng disenyo ng kubyertos sa restaurant na ito.

25. Ayaw kong sumakay ng bus kung minsan.

26. Les systèmes d'intelligence artificielle peuvent être utilisés pour résoudre des problèmes complexes.

27. Nakasabit ang mga larawan ng mga nangungunang mag-aaral sa silid-aralan upang bigyan ng inspirasyon ang mga bata.

28. Pinagmamasdan niya ang magandang tanawin mula sa tuktok ng bundok.

29. Nasa Canada si Trina sa Mayo.

30. The United States has a system of checks and balances, where each branch of government has the power to limit the power of the other branches

31.

32. Cultivar maíz es un proceso muy gratificante, ya que el maíz es una de las principales cosechas en todo el mundo

33. Ang mga salaysay tungkol sa buhay at mga gawain ni Rizal ay naging paksa ng mga akademikong pag-aaral at pagsasaliksik.

34. Ang ibig Sabihin ng morena ay hindi maitim hindi maputi

35. Ang paglapastangan sa kalikasan ay nagdudulot ng malalang epekto sa ating kapaligiran.

36. Ang mga halaman sa bukid ay natutuyo dahil sa matinding tagtuyot.

37. I have been jogging every day for a week.

38. Ailments can impact different populations disproportionately, such as people of color, women, and those with low socioeconomic status.

39. Samvittigheden kan være en påmindelse om vores personlige værdier og moralske standarder.

40. Ang pagkakaroon ng mga programa at kampanya sa paglaban sa droga ay mahalaga upang maiwasan ang pagkalat nito sa lipunan.

41. Nakita ko ang aking guro sa mall kanina kasama ang kanyang pamilya.

42. Las escuelas ofrecen diferentes planes de estudios, dependiendo del nivel y la especialización.

43. Kareem Abdul-Jabbar holds the record for the most points scored in NBA history.

44. Musk has been vocal about his concerns over the potential dangers of artificial intelligence.

45. Naglakad kami sa gubat na mayabong ng mga punong-kahoy, at naramdaman namin ang sariwang hangin.

46. Twitter allows users to send direct messages (DMs) to each other for private conversations.

47. Pinagmamalaki ng mag-asawa ang kanilang anak dahil hindi lang maganda si Lorena kundi ay matalino at may mabuting kalooban din.

48. Ang marahas na paggamit ng lakas ay labag sa etika at pagkamamamayan.

49. Patients are usually admitted to a hospital through the emergency department or a physician's referral.

50. Malayo ho ba ang estasyon ng tren?

Recent Searches

panindangrosellekinantabalangmalikotfitkasakitbulakkahitcompositoresalagangtapekasingtigasanaytshirtwalongmansanasmukasignhomesumaagossumigawstoyataboholhehemeaningkinainkaboseskwebablazingnagbasaipatuloysedentarypulubivehiclesredigeringkapetradelintaadangcasaparocultivaginisingdamitimaginationafternooncebu18thmapaikotnagreplybabaelateboyetbumababaprocesowalistenderpshbatopartylegendssumabogsukatcivilization1000kadaratingmaluwangsenatelamanpaskoyepreportkarnabalnakabaonpromotingratedonetransitgenerationertsaadelelaylaytvsinisbumugapasoknag-iinomprogramaeffectneedscreateandroidhalosfacehighestformatimprovedsummitbilingbumilisfe-facebookburgerstatusexpectationsfacilitatingmagpakasalpagpasensyahanseguridadmahiwagasinumancosechakulunganumiisodpamagathagdanantanyagginagawakabighamario11pmanteslakasauditagilityfistssandalingactingmacadamiasobraipipilithardplaysagehalikalibagrealisticpintuandivisiontiyaprovidedbatikarwahengnapupuntamatabangmagsungitminatamiskumaliwanakakarinigkailanmanlolorewardingmalapitannetflixlightskaano-anodiyandollarstandconditioningbringingmatiwasay1982everyaustraliacreationbeyondmitigatenagtitiisselebrasyonuulitinmaglinisnakiisapagngitiinihandahojasmulexperience,celularesbakacanteendalawamakahingimakikipag-duetogamepresentanagwikangnayondinibakesumagotpootpumasokpagpapatuborosarioevenmasaraprenombreanong