Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

2 sentences found for "pamanhikan"

1. Isasama ko ang aking mga kapatid sa pamanhikan.

2. Kasama ko ang aking mga magulang sa pamanhikan.

Random Sentences

1. La conexión a internet se puede hacer a través de una variedad de dispositivos, como computadoras, teléfonos inteligentes y tabletas.

2. Cheating is a personal decision and can be influenced by cultural, societal, and personal factors.

3. The credit check for the apartment rental revealed no red flags.

4. Ang mga matatamis na melodiya ng kundiman ay nakakapukaw ng damdaming umiibig.

5. Kulay pula ang libro ni Juan.

6. Ang bayanihan ay nagpapakita ng pagkakaisa at pagtutulungan sa pagharap sa mga hamon ng buhay.

7. Selling products: You can sell products online through your own website or through marketplaces like Amazon and Etsy

8. Siguro matutuwa na kayo niyan.

9. Habang naglalaba, napadungaw siya sa labas at napansin ang magandang paglubog ng araw.

10. Has she read the book already?

11. Nasi goreng adalah salah satu hidangan nasional Indonesia yang terkenal di seluruh dunia.

12. En invierno, se pueden ver hermosos paisajes cubiertos de nieve y montañas nevadas.

13. Elektronik kan være en kilde til underholdning og sjov.

14. Nanlaki ang mata ko saka ko siya hinampas sa noo.

15. Arbejdsgivere tilbyder ofte sociale fordele som sygesikring og betalt ferie.

16. Puwedeng gamitin ang pagguhit upang mag-disenyo ng mga damit at mga bagay-bagay.

17. The momentum of the wave carried the surfer towards the shore.

18. Upang magpalago ng mais, kailangan mong magsimula sa pamamagitan ng pagpili ng tamang lugar para sa iyong halaman

19. Scientific research has shown that regular exercise can improve heart health.

20. Basketball players wear special shoes that provide support and traction on the court, as well as protective gear such as knee pads and ankle braces.

21. Musk's SpaceX has successfully launched and landed reusable rockets, lowering the cost of space exploration.

22. Además, el teléfono ha sido una herramienta valiosa en la venta telefónica y en la realización de encuestas

23. Bumabaha sa amin tuwing tag-ulan.

24. Ano ang sukat ng paa ni Elena?

25. Kasama ng kanilang mga kapatid, naghihinagpis silang lahat sa pagkawala ng kanilang magulang.

26. Masarap ang bawal.

27. The team won a series of games, securing their spot in the playoffs.

28. In a small cottage, three little pigs named Peter, Paul, and Percy lived with their mother.

29. Gracias por todo, cuídate mucho y nos vemos pronto.

30. Bakso adalah bola daging yang disajikan dengan mie dan kuah kaldu.

31. Patuloy ang labanan buong araw.

32. Si Hidilyn Diaz ay nag-ensayo sa Malaysia bago sumabak sa Tokyo Olympics.

33. I fell for an April Fool's joke on social media this year - a friend posted a fake news article that was so convincing I thought it was real.

34. Sa tulong ng meditasyon, mas napalalim ang aking kamalayan sa aking sarili at emosyon.

35. Bumoto ka nang ayon sa idinidikta ng iyong puso.

36. Omelettes are a popular choice for those following a low-carb or high-protein diet.

37. Forgiveness is an act of liberation, allowing us to reclaim our power and live our lives free from the burden of past hurts.

38. Kings may wield absolute or constitutional power depending on their country's system of government.

39. Aku merindukanmu, sayang. (I miss you, dear.)

40. Paano tayo? Di mo pa sinasagot yung tanong ko. aniya.

41. Ang mag-asawa ay may hanapbuhay na paghahabi ng mga tela.

42. It is important to be patient and persistent, and to not get discouraged if you encounter obstacles along the way

43.

44. Magtatampo na ako niyan. seryosong sabi niya.

45. He realized too late that he had burned bridges with his former colleagues and couldn't rely on their support.

46. La visualisation et la réflexion sur ses réussites passées peuvent également aider à maintenir la motivation.

47. Paano po pumunta sa Greenhills branch?

48. L'intelligence artificielle peut aider à optimiser les processus de production industrielle.

49. El actor hizo un comentario controversial que está llamando la atención de los medios.

50. Cancer can affect any part of the body, including the lungs, breasts, colon, skin, and blood.

Recent Searches

travelerpamanhikanparinantoniomilapatakbopuwedestopalasyopagsubokbiyerneskaaya-ayanghampasfencingapatnapucocktailemocionalinaminnanunuksohappenedtatanggapinretirarreaksiyonkayanagbentamagsabiincreasednapakahabakumukulojoshuanagliwanagpresence,dyosaikinagagalakkaano-anogayunmannakapaligidkilayyourself,estasyonsumalipesosmenosclientesmuchanandyanmakipagkaibigannakahigangmagsusunuranirogrobinhoodkinse1980matangkadilocosinimbitatseviewsmagagamitbalahibosiyamcommunityplatformstelaspecialshowsipag-alalapartiesfreemagkamalinag-aaralkakaibangvisualbinilingmagkasabaynakapagreklamonapatawagawtoritadongpakialamcalciumnagsilapitlalapitpagdatinggrowthhalamanapoypinapanoodpangyayaripedesingerbakantesisidlanclassmatepagbahingwriting,lumusobdahilkikitafilmsocceranim1940yeykasamaangtelebisyonellenlargepakiramdamkomedorgayundinbumuhossumakaymagdamagannauntogsinaliksikpitokinagatteleviewingginisingpupuntasinokasamahahanapinagatsuperpampagandahiningistruggledilingbinawianfeelingkumikinigkasodulotiilanclassroomklasrummabaitmagdamagcoachingwastesugalmahiramtakesanimoygamotkumbentoleonamalagiparamasasakitngumitipulisaudio-visuallyhanapinpalawansensiblefysik,dinisandokkainanisinakripisyosino-sinomagalinginiirogmakatulogerlindacesabsmaliksimisteryosongmayo1982maramotlakiitsurataga-suportakumitanagyayangtinatanongmabatongpinangalanangnakainomsalenakakadalawvelstandkanyanagulatviolencedyipnagsilabasanlockednoonmanggahoneymoonsabongtibokkruskalanintroduce