Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

35 sentences found for "book:"

1. A couple of hours passed by as I got lost in a good book.

2. Don't assume someone's personality based on their appearance - you can't judge a book by its cover.

3. Don't dismiss someone just because of their appearance - you can't judge a book by its cover.

4. Don't underestimate someone because of their background - you can't judge a book by its cover.

5. Format your book: Once your book is finalized, it's time to format it for publication

6. Has she read the book already?

7. He might be dressed in casual clothes, but you can't judge a book by its cover - he's a successful business owner.

8. He might look intimidating, but you can't judge a book by its cover - he's actually a really nice guy.

9. Here is a step-by-step guide on how to make a book: Develop an idea: Before you start writing, it is important to have a clear idea of what your book will be about

10. I am not reading a book at this time.

11. I am reading a book right now.

12. If you are self-publishing, you will need to choose a platform to sell your book, such as Amazon Kindle Direct Publishing or Barnes & Noble Press

13. In conclusion, making a book is a creative and fulfilling process that requires planning, research, and hard work

14. Just because she's quiet, it doesn't mean she's not intelligent - you can't judge a book by its cover.

15. Just because someone looks young, it doesn't mean they're not experienced - you can't judge a book by its cover.

16. Make sure to keep track of your sources so that you can properly cite them in your book

17. Many people think they can write a book, but good writers are not a dime a dozen.

18. Nag-book ako ng ticket papunta sa Ilocos.

19. Promote your book: Once your book is published, it's important to promote it to potential readers

20. Quiero ser escritor y publicar un libro algún día. (I want to be a writer and publish a book someday.)

21. Research: Depending on the subject of your book, you may need to conduct research to gather information and support your ideas

22. Sa kasal, ang pagdadala ng mga panulat ay mahalaga upang masigurong makapagsulat ng matatalinong mensahe sa guest book.

23. She has finished reading the book.

24. The car might look old, but you can't judge a book by its cover - it's been well-maintained and runs smoothly.

25. The feeling of finishing a challenging book can be euphoric and satisfying.

26. The Jungle Book introduces Mowgli, a young boy raised by wolves, as he encounters various jungle animals and learns life lessons.

27. The novel might not have an appealing cover, but you can't judge a book by its cover - it could be a great read.

28. The restaurant might look unassuming from the outside, but you can't judge a book by its cover - the food is amazing.

29. Think about what message you want to convey, who your target audience is, and what makes your book unique

30. This can include creating a website or social media presence, reaching out to book reviewers and bloggers, and participating in book signings and events

31. When I arrived at the book club meeting, I was pleased to see that everyone there shared my love of literary fiction. Birds of the same feather flock together indeed.

32. With dedication, patience, and perseverance, you can turn your manuscript into a finished book that you can be proud of

33. Writing a book can be a rewarding experience, whether you are writing for personal fulfillment or to share your knowledge and expertise with others

34. Writing a book is a long process and requires a lot of dedication and hard work

35. You can't judge a book by its cover.

Random Sentences

1. Hindi maikakaila, mas malakas ang pamilyang magkakasama.

2. Mawala ka sa 'king piling.

3. Gusto kong bumili ng bagong cellphone, datapwat ang aking kasalukuyang cellphone ay gumagana pa naman.

4. Yes Sir! natatawa pa ako saka ko binaba yung tawag.

5. Tila ngayon ko lang napansin ang kwebang ito.

6. Pumasok sa sinehan ang mga manonood nang limahan.

7. Ang paborito niyang laruan ay Beyblade.

8. Ang Tagaytay ay itinuturing na "Little baguio dahil sa lamig ng klima dito".

9. Ang kulay ng langit sa takipsilim ay parang obra maestra.

10. Sa tuwing binabalewala ako ng ibang tao, naglalabas ako ng malalim na himutok sa loob ng aking puso.

11. Bukas ay magpapagupit na ako ng buhok.

12. Les enseignants peuvent utiliser diverses méthodes pédagogiques pour faciliter l'apprentissage des élèves.

13. Les enseignants peuvent encadrer des clubs étudiants pour promouvoir les compétences sociales et artistiques des élèves.

14. Si John ay isang mabuting kaibigan, datapwat minsan ay napag-uusapan namin ang mga hindi magandang bagay.

15. Nang magbago ang mga pangyayari at matanggap ko ang mga kaganapang hindi ko inaasahan, ang aking pagkabahala ay napawi.

16. Makinig ka sa 'king payo pagkat musmos ka lamang.

17. Ang paglapastangan sa mga kagamitan at ari-arian ng iba ay isang paglabag sa mga prinsipyong moral.

18. Amazon has been involved in the development of autonomous vehicles and drone delivery technology.

19. Hindi malinis ang tubig na iyan, bumili ka ng iba.

20. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

21. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

22. Los Angeles is considered the entertainment capital of the world, with Hollywood being the center of the film and television industry.

23. Ang magnanakaw ay mahigpit na inabangan ng mga pulis matapos ang operasyon.

24. Sumang ayon naman sya sa mungkahi ng kanyang kasintahan.

25. Lontong sayur adalah hidangan nasi lontong dengan sayuran dan bumbu yang khas Indonesia.

26. She's always gossiping, so take what she says with a grain of salt.

27. Napaluha si Aling Pising nang makita niya ang bunga nito.

28. May mga taong may kondisyon tulad ng insomnia na nagdudulot sa kanila ng problema sa pagtulog.

29. Mahalaga ang regular na pagsisipilyo at paggamit ng dental floss upang maiwasan ang mga sakit sa bibig.

30. Hvis man oplever smerter eller ubehag under træning, er det vigtigt at stoppe og konsultere en sundhedsprofessionel.

31. Lumingon ako para harapin si Kenji.

32. Ailments can impact one's daily life, including their ability to work, socialize, and engage in activities.

33. Foreclosed properties may be sold through real estate agents or brokers, who can help buyers navigate the purchase process.

34. Les travailleurs indépendants travaillent souvent à leur propre compte.

35. Dahil sa bayanihan, naging matagumpay ang aming pagtatanim ng mga pananim sa taniman.

36. Emphasis can be used to highlight a person's strengths and abilities.

37. El amanecer en la montaña es un momento sublime que nos conecta con la naturaleza.

38. The platform offers various filters and editing tools to enhance the appearance of photos before posting.

39.

40. I have been watching TV all evening.

41. Seeing a long-lost friend or family member can create a sense of euphoria and happiness.

42. Dahil alam niyang galit na ang kanyang ina ay di na umimik si Pinang.

43. Dalawang libong piso ang palda.

44. Comer alimentos frescos y no procesados puede ayudar a reducir el riesgo de enfermedades cardíacas y diabetes.

45. Nutrient-rich foods are fundamental to maintaining a healthy body.

46. Tumayo ako para tingnan yung itsura ko ngayon.

47. Nakakapagod pala umakyat ng bundok.

48. Mas romantic ang atmosphere sa dapit-hapon.

49. But television combined visual images with sound.

50. Naghingi ako ng pahintulot na hiramin ang kotse ng aking magulang para sa isang family outing.

Recent Searches

book:nagbalikreaksiyonsingaporebulonghvoraseantalentdibdiblandokapatawarankapasyahanmatalikpala4thplanmakuhakarapatangmasikmuraditonamanpinabulaanniyanggenerateipanlinisnaghihirapnamalagimakamitdistansyanagbasaganitoskillsdistancesledmagpagalingdivisoriamagalingaga-agailandumikitmukhangmaalogjingjinglumuhodpunung-punopinagkasundonagtatampomgalegendstayopinakamaartengpakaininkubomagtakaamerikatelefonerparkkinaiinisanhumbleitinanimamericaalongworryedukasyongalingngayonkasaganaananywhereagadmasinopsawsawanasiabilanginpagpangkatsagotexamnabiglavarietypag-asanaghanapmakuhangtaonkanya-kanyangkaano-anoinalagaankagustuhangpresyolaterbentangclimafeelingteachthingslangostalangkaycleanprosesocontinuessisidlanhitikcrossadditionasignaturaganaitimdahiltapeinjurynalugmoktag-arawhissupilinlittlesiglabutilmahiwagangmariahigitmasayanglalabaskinatatakutanmemorialbigongpaparusahanmayabongkatipunanbinilhantripconstantlypaki-translatepaketecomunesmatulunginseenmanuelngisipintuanpunodyosanagdaramdamtagtuyotjobmakilalabesesprofoundhoneymoonerstawaglagaslaspaparamitrinapagkapitaskaymaghandasumpunginmuchasmag-asawamakikitulogkalakihansourcesnakabasagxixgitanasfeedback,mabirobagbagaystateconvey,vibrateabangkinahuhumalinganmayosaudihidingproduktivitetcrazywalngstyleskillpalakapuntapakikipagtagpopinsanbolanaunaabsproducererhamakmagsi-skiinghihigaomgfinalized,danzaadvancementhorsemakapilingkwebatwinkleshopee