Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "fysik,"

1. Videnskaben er opdelt i flere forskellige discipliner, såsom fysik, kemi, biologi og geologi, og hver disciplin har sin egen metode og fokusområde

Random Sentences

1. The telephone quickly caught on, and by 1878, Bell's company, the Bell Telephone Company, had more than 50,000 subscribers

2. La realidad a veces es cruel, pero debemos enfrentarla con valentía.

3. The intensity of baby fever can vary from person to person, with some feeling a passing longing and others experiencing a persistent and overwhelming desire.

4. You can find freelance writers who are willing to work for cheap rates, but good ones are not a dime a dozen.

5. Napangiti ang babae at kinuha ang pagkaing inabot ng bata.

6. It's so loud in here - the rain is coming down so hard it's like it's raining cats and dogs on the roof.

7. Leukemia can be challenging to treat, and some patients may require multiple rounds of therapy.

8. LeBron has since played for the Los Angeles Lakers, joining the team in 2018.

9. This can include creating a cover, designing the interior layout, and converting your manuscript into a digital format

10. No puedo imaginar mi vida sin mis amigos, son una parte muy importante de ella.

11. Ang amoy ng bagong simoy ng hangin ay napakarelaks at mabango sa amoy.

12. Basketball players are known for their athletic abilities and physical prowess, as well as their teamwork and sportsmanship.

13. Nagtaka ito sa pagbabagong-anyo ni Kiko hanggang maging maliit na hayop na animo'y bayawak.

14. The backpack was designed to be lightweight for hikers, yet durable enough to withstand rough terrain.

15. Naku, ang taas pala ng temparatura ko.

16. Ang kalawakan ay punung-puno ng mga bituin.

17. Sa larangan ng negosyo, ang mailap na customer ay mahirap makuha at panatilihin.

18. Magtatapos ako ng aking thesis sa buwan na ito, datapwat kailangan kong maglaan ng mas maraming oras para dito.

19. Ibinigay niya ang kanyang pag-ibig at suporta sa gitna ng mga pagsubok.

20. Arabica beans are generally considered to be of higher quality and have a milder flavor.

21. Robert Downey Jr. gained worldwide recognition for his portrayal of Iron Man in the Marvel Cinematic Universe.

22. When in Rome, do as the Romans do.

23. L'auto-discipline est également importante pour maintenir la motivation, car elle permet de s'engager dans des actions nécessaires même lorsque cela peut être difficile.

24. Ang kabayanihan ni Rizal ay patuloy na pinararangalan sa pamamagitan ng pagdiriwang ng kanyang kaarawan at mga aktibidad sa buong bansa.

25. Mataaas na ang araw nang lumabas si Aling Marta sa bakuran ng kanilang maliit na barung-barong.

26. Sa harap ng libingan, naghihinagpis ang mga kaibigan at pamilya ng namayapang kaibigan.

27. They are often served with a side of toast, hash browns, or fresh greens.

28. Para sa anak ni Consuelo ang T-shirt.

29. In recent years, the telephone has undergone a major transformation with the rise of mobile phones

30. Representatives are individuals chosen or elected to act on behalf of a larger group or constituency.

31. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

32. Everyone knows that she's having an affair, but nobody wants to talk about the elephant in the room.

33. And she said yes? parang nag-aalangan kong tanong.

34. Our relationship is going strong, and so far so good.

35. Bakit wala ka bang bestfriend?

36. Kung walang tiyaga, walang nilaga.

37. They must maintain transparency and communicate with their constituents to build trust and ensure representation is effective.

38. Ang sugal ay maaaring magdulot ng pagkawala ng pag-aasenso at pagkakataon sa buhay.

39. Emphasis can be used to provide clarity and direction in writing.

40. Las escuelas ofrecen programas educativos desde preescolar hasta la universidad.

41.

42. Kahit pagod ka na sa trabaho, nakakarelax ang paglalakad sa dapit-hapon.

43. Sapagkat baon sa hirap ang lahat, napipilitan silang maging sunud-sunuran sa napakatakaw na mangangalakal.

44. Napupuno ako ng poot sa tuwing naaalala ko ang mga pagkakataon na ako'y pinagtaksilan at sinaktan.

45. Sabay nanaog at pumitas ng halaman sa hardin at nagtuloy sa ilog upang pagmasdan ang bulaklak sa kanyang buhok.

46. Inakalang magtatagal ang kanilang relasyon, pero naghiwalay din sila.

47. These films helped to further cement Presley's status as a cultural icon and helped to solidify his place in the history of American entertainment

48. Cheating can occur in many forms, including physical infidelity, emotional infidelity, or both.

49. Traveling to a conflict zone is considered very risky.

50. Maraming mga uri ng droga, tulad ng marijuana, cocaine, heroin, at methamphetamine.

Recent Searches

maligayafysik,befolkningen,dyipnitraditionaltelecomunicacioneshouseshadesreviewiloilodekorasyonexpeditednakalockipapainitlarawanyespasaheromagandangnakahugmataaaspagkagustonovemberexperience,sabihinmalapitanricoparonapakasinungalingbumitawnoonpasahenagtatrabahodamdaminnararapatikinamatayinformationpagkaimpaktolastinghurtigerepagbatimartessabong2001japanstorybulaumigibtsaamacadamiawouldunosnagkakasyadettemaaringelvisshouldsipatrycycleprogressoutpostlasingpracticadoceslumilipadlihimmakausapuniversitysaranggolabigasdistanciasalitangusuariokinahuhumalinganpinagmetodeyeheyipantalopsampungabonoetoflexiblenakapapasonghinintaybilhinsarita1977nagdabogkumatoktabasheyamerikawordrollpedekinagalitankalikasanbroadpwestomantikaschoolssaraevolucionadodiscoveredkelanpaga-alalanakilalainsidentedanceplasakasingtigasthenenhederikinagagalakpalagimediumimpactedtusongbitbitguidancesalu-salolaguna1940matakawmethodsbibisitapreskomaaliwalasnakauwitelangampliamaratingpinagbigyansweetnakakasamasamunanditonagbabalatermubonakabulagtangnakatuoniyaktopicflamencodecreaseinakalapayayawcontinuedsikobroughtbumigaytirangnagreklamochoicetumangoboxwithoutcarlomanatilipaslitcorrectingkinasuklamannaalisnamuhaymeanskailanmanmejona-fundmasayangbabeagostohalu-haloweremagbunganagbanggaanagepetsangnatatawapalengkeforskel,institucionesusotinitindasandalistylesgrowthbroadcastsnagplaypinakamaartengbringmagdaraosnanonoodtabaipagamotsolarumiyaknakapagproposenanlilimahidsiyudad