Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

5 sentences found for "addition"

1. In addition to his martial arts skills, Lee was also a talented actor and starred in several films, including The Big Boss, Fists of Fury and Enter the Dragon

2. In addition to his martial arts skills, Lee was also known for his philosophical ideas and his emphasis on personal development

3. In addition to his musical career, Presley also had a successful acting career

4. In addition to his NBA success, LeBron James has represented the United States in international basketball competitions, winning two Olympic gold medals in 2008 and 2012.

5. The acquired assets will be a valuable addition to the company's portfolio.

Random Sentences

1. Scientific experiments have shown that plants can respond to stimuli and communicate with each other.

2. The restaurant has a variety of options on the menu, from vegetarian to meat dishes.

3. The athlete completed a series of intense workouts to prepare for the competition.

4. Tim Duncan was a fundamental force in the NBA, leading the San Antonio Spurs to numerous championships.

5. Aling lapis ang pinakamahaba?

6. Aling telebisyon ang nasa kusina?

7. Mi amigo del colegio se convirtió en un abogado exitoso.

8. Ngayon lang ako nag mahal ng ganito.

9.

10. The weather today is absolutely perfect for a picnic.

11. Ngunit hindi niya alam na nakasunod ang mga kababayang niyang walang ibang inisip kundi makakuha ng pagkain.

12. Hinawakan niya iyon sa magkabilang tirante.

13. At ignorere sin samvittighed kan føre til følelsesmæssig fjernhed og isolation.

14. Ang carbon dioxide ay ina-absorve ng mga puno.

15. Sa labas ng bintana, natatanaw ko ang mga batang naglalaro sa kalye.

16. Bumabaha sa amin tuwing tag-ulan.

17. Los héroes son ejemplos de liderazgo y generosidad.

18. Hockey coaches develop game plans and strategies to help their team succeed.

19. Emphasis can be used to create a sense of drama or suspense.

20.

21. Sunud-sunod na nakatalungko ang mga ito sa isa pang bangkong nas atagiliran ng nanggigimalmal na mesang kainan.

22. Einstein's intellectual curiosity, creativity, and persistence in the face of challenges serve as a model for aspiring scientists and scholars.

23. Kung may isinuksok, may madudukot.

24. El sismo produjo una gran destrucción en la ciudad y causó muchas muertes.

25. Over-emphasis can be counterproductive and may undermine the intended message.

26. Ang mga anak-pawis ay nangangailangan ng patas na pagkakataon upang magkamit ng tagumpay at umangat sa buhay.

27. I know this project is difficult, but we have to keep working hard - no pain, no gain.

28. Napangiti siyang muli.

29. Ang carbon dioxide ay inilalabas ng mga tao.

30. Habang nagluluto, nabigla siya nang biglang kumulo at sumabog ang kawali.

31. Ang mga kundiman ay nagpapahayag ng kahalagahan ng pag-ibig at pagmamahal sa ating bayan.

32. La música clásica es una forma de música que ha existido durante siglos.

33. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

34. Biglang nagulat ang bata nang lumitaw sa harp niya ang isang duwende.

35. The United States has a system of government based on the principles of democracy and constitutionalism.

36. She is not designing a new website this week.

37. Maarte siya sa mga lugar na pupuntahan kaya hindi siya nakikipagsiksikan sa mga madaming tao.

38. Ang mga NGO ay nag-aapuhap ng donasyon upang matulungan ang mga batang ulila.

39. Sang-ayon ako sa kagustuhan mo na magpatuloy sa iyong pag-aaral.

40. Ang pagtambay sa ilalim ng puno ay nagdudulot ng maginhawang lilim mula sa init ng tanghali.

41. All these years, I have been learning to appreciate the present moment and not take life for granted.

42. Las personas pobres a menudo enfrentan discriminación y estigmatización en la sociedad.

43. The project is on track, and so far so good.

44. The team is working together smoothly, and so far so good.

45. Eine hohe Inflation kann die Investitionen in die Wirtschaft verlangsamen oder sogar stoppen.

46. Ang tugtugin ay may mababa ngunit malalim na tono.

47. Limitations can impact one's career, relationships, and overall quality of life.

48. Sa larong volleyball, ipinasa ni Liza ang bola sa kanyang kakampi.

49. Kebahagiaan adalah perjalanan pribadi yang unik bagi setiap individu, dan penting untuk menghormati dan mencari kebahagiaan yang paling sesuai dengan diri sendiri.

50. Nakakatakot ang paniki sa gabi.

Similar Words

AdditionallyAdditionally,

Recent Searches

lumabasguidanceadditionjoshuagabrieldumaramijeromeincidencetatlongharinggrabenalugitilgangmaintindihaniniuwitumunognangangalogpersistent,dadmakatatloayawhusomarangalbinigaymaghintayotroidiomapasaherosistermagpa-checkupsarabeforeprovejanesameprovidedregularmentesugatanghospitalcorporationvictoriaanilanatuyodomingomasayahinlumulusobmalulungkotcontinueberkeleynaghinalakanikanilanginspirationrevolutioneretsellingpangarapmanonoodsarilifinishednaguguluhannagwikangikinatatakotbayaningdarkwouldginaganoonpollutionundeniableginasedentaryprogresslasingtumatakbonakakatabanaroonlawaymaulitmaibabalikmaaringlilytungawmayabongtsismosasinonabasakamie-commerce,apatnapufionaprodujonakatuwaangautomatiskskypeinsidentekikilosstonewskumustanagpepekekwebadividedinantaynagbentajuicepalancaintramurospinakidalainakyatintotanimankomunikasyonespecializadasayokobyggetginagawaclientemighttagalnag-isipnotebookoperatemakaratingnapakahangakusinapresleyboyfriendkanilacanteenmagawapamahalaantulongkaraokeumarawamountnalalaglagrobinhoodputahebruceleopinyamedidaplaniniintayandamingcompletamentepyestacornerbalangsingaporesino-sinokarapatanginjuryhamakpanindangbumababamukhanagtatanonggiyeranagtrabahomaibapakistandumilatmallpatiencefrogbatokbalanceslookedtopic,tsinelasquicklyoutpostbubongbumaliknahigitannanggagamotbumaba1787isinulatmuylaryngitiscontestmulistylesumigtadmagtanimknowlisteningmaglutodalagapositibodisappointitinulostillmakabalikkapilingbakeresearch,mauliniganipagbilileyte