Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

15 sentences found for "develop"

1. Ailments can be a source of inspiration for medical research and innovation to develop new treatments and cures.

2. As AI algorithms continue to develop, they have the potential to revolutionize many aspects of society and impact the way we live and work.

3. Basketball can be a fun and engaging sport for players of all ages and skill levels, providing an excellent opportunity to develop physical fitness and social skills.

4. Dogs can develop strong bonds with their owners and become an important part of the family.

5. Football coaches develop game plans and strategies to help their team succeed.

6. Here is a step-by-step guide on how to make a book: Develop an idea: Before you start writing, it is important to have a clear idea of what your book will be about

7. Hockey coaches develop game plans and strategies to help their team succeed.

8. Leukemia research continues to improve our understanding of the disease and develop more effective treatments.

9. Mathematics helps develop critical thinking and problem-solving skills.

10. Pets, including dogs, can help children develop empathy and responsibility.

11. The scientific community is working to develop sustainable energy sources to combat climate change.

12. The success of Tesla has had a significant impact on the automotive industry, inspiring other automakers to invest in electric vehicle technology and develop their own electric models.

13. Ultimately, a father is an important figure in a child's life, providing love, support, and guidance as they grow and develop into adulthood.

14. Viruses have been used in genetic engineering and biotechnology to develop new therapies and treatments.

15. While the advanced countries in America and Europe have the wealth and scientific know-how to produce solar and nuclear energy on a commercial scale, the poorer Asiatic countries like India, Pakistan, and Bangladesh may develop an energy source by bio-gas-developing machines

Random Sentences

1. Sumama ka sa akin!

2. Sa mga sitwasyon ng buhay, ang mailap na oportunidad ay kailangan mabilis na kinukuha.

3. Patuloy ako sa paglinga nang may mamataan ang mga mata ko.

4. Ngumiti ako saka humalik sa mga labi niya.

5. Les enseignants peuvent être amenés à enseigner dans des écoles différentes en fonction de leurs besoins professionnels.

6. Seeking support from friends, family, or a mental health professional can be helpful in managing feelings of frustration.

7. Kailangan nating magbago ng mga lumang gawi, datapapwat ay mahirap ito gawin dahil sa kawalan ng disiplina ng iba.

8. Ano ang sukat ng paa ni Elena?

9. Hashtags (#) are used on Twitter to categorize and discover tweets on specific topics.

10. Las escuelas son lugares de aprendizaje para estudiantes de todas las edades.

11. I have lost my phone again.

12. Alam na niya ang mga iyon.

13. The hotel might offer free breakfast, but there's no such thing as a free lunch - the price of the room is probably higher to compensate.

14. Bawal magpapakalat ng mga fake news dahil ito ay nagdudulot ng kaguluhan at kawalan ng tiwala sa media.

15. Las redes sociales son una plataforma para compartir fotos y videos.

16. Umalis na siya kasi ang tagal mo.

17. La adicción a las drogas puede afectar negativamente las relaciones familiares y de amistad.

18. He listens to music while jogging.

19. Scissors are a cutting tool with two blades joined together at a pivot point.

20. Uuwi si Ellen sa Cebu sa Pasko.

21. Nagsusulat ako ng mga ideya at kaisipan sa aking diary.

22. Påsketiden er en mulighed for at tilbringe tid sammen med familie og venner og nyde det forårsagtige vejr.

23. The company acquired assets worth millions of dollars last year.

24. Tweets are limited to 280 characters, promoting concise and direct communication.

25. Ang sarap kumain sa labas presko ang hangin.

26. Está claro que necesitamos más tiempo para completar el proyecto.

27. Quiero contribuir a la protección del medio ambiente y hacer del mundo un lugar mejor para vivir. (I want to contribute to the protection of the environment and make the world a better place to live.)

28. Los sueños son la semilla de nuestras acciones y logros. (Dreams are the seed of our actions and achievements.)

29. Ang sampaguita ang pambansang bulaklak ng Pilipinas.

30. Busy pa ako sa pag-aaral.

31. Scientific research has shown that meditation can have a positive impact on mental health.

32. Hoy ano ba! Wag kang pakelamero! galit na sabi ni Cross.

33. Anong nakakatawa? sabay naming tinanong ni Sara

34. Sa loob ng paaralan, ang ingay ng mga mag-aaral ay binulabog ang kasiyahan ng mga guro.

35. Håbet om at opnå noget kan motivere os til at tage skridt for at nå vores mål.

36. His unique blend of musical styles, charismatic stage presence, and undeniable talent have cemented his place in the pantheon of American music icons

37. The United States has a diverse landscape, with mountains, forests, deserts, and coastal regions.

38. Einstein's writings on politics and social justice have also had a lasting impact on many people.

39. Instagram offers insights and analytics for users with business accounts, providing data on post performance and audience demographics.

40. Huwag kang gagamit ng illegal na droga.

41. The Victoria Falls in Africa are one of the most spectacular wonders of waterfalls.

42. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

43. Kung anu ano ang kanilang pinag-usapan hanggang sa bigla na lang napabalikwas ang prinsipe na tila ba may tumawag sa kanya.

44. Natakot ang pusa sa tunog ng paputok kaya't kumaripas ito papasok sa bahay.

45. J'ai acheté un nouveau sac à main aujourd'hui.

46. El que espera, desespera.

47. Naglalaro sa isip niya na ngayong napakalakas ng ulan lalo siyang magtataas ng presyo.

48. Isinawak niya ang kamay, pinagkiskis ang mga palad at pagkaraa'y naghilamos.

49. Sa agaw-buhay na mundo ng sports, mahalaga ang tiwala sa sarili at sa mga kasama sa koponan.

50. Nakikita ko ang halinghing ng mga bata habang naglalaro sa parke.

Similar Words

developedbio-gas-developingdevelopment

Recent Searches

tutorialsknowledgeaddingdevelopmemoryinitsequevisualsolidifycurrentprogramsinformedrefworkshoppatricksettingjunjuntypessupportincreasededicationvanactorcallingiginitgitilingconsiderroughanothermenulipadalbularyoinasikasonakaririmarimnagulatnagbiyayamamanhikancigarettekangkongutak-biyapagsisisipagkalitohampaslupainvesting:naibibigaypaanongnagmadalingtoopawiinbatayyumabongbabasahinbeautyairportactualidadnareklamodalawaformassalbahengpartsilalagaypaglalabalabinsiyamnapakagandalumayoyumuyukopakikipaglabanalapaapmiyerkulestumamisnasaankatagangumiyakmusicalesdonkriskacolorkapainkarangalancapacidadsundaeituturokulotyarimedyomarmaingmakahingihumblenicopaksainihandatanyagreguleringbinasaparangtanodindustrydedication,tinitirhantsakaumiinomcomputernakonsiyensyabasaactivitytoolfacultysambitadaptabilitywalletkasinggandaikinalulungkotgeneratedusingnapilinggapmulingmonitorediteffectpagkakamalipaskongpaki-ulittataasnatulakkasaysayanobra-maestrasamakatwidmatulisinvestnag-alalainiinomtillnilulonmapaibabawharappagodsalamakisigsantonoofurfueltakes1940pinatidsnobjudicialreportgrabedeviceshelpfulmapadalilayout,teamlockdowndecisionssulingancomunesfuncionarstorehitbornsagingvasquesbosesshockthroughoutfuncionesnagingbeinteshapinggenerationerdelepulaanimulireserbasyonnakakagalingmerlindaikinamataypaki-translatemarketplacesnakakatawavideos,salamangkeropagpapakilalanakakapasokmagpa-checkupanibersaryopagkakatayounibersidadpagkakatuwaangumagalaw-galawmurang-muravirksomheder,bagkusklasengpabalikvaccines