Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

15 sentences found for "develop"

1. Ailments can be a source of inspiration for medical research and innovation to develop new treatments and cures.

2. As AI algorithms continue to develop, they have the potential to revolutionize many aspects of society and impact the way we live and work.

3. Basketball can be a fun and engaging sport for players of all ages and skill levels, providing an excellent opportunity to develop physical fitness and social skills.

4. Dogs can develop strong bonds with their owners and become an important part of the family.

5. Football coaches develop game plans and strategies to help their team succeed.

6. Here is a step-by-step guide on how to make a book: Develop an idea: Before you start writing, it is important to have a clear idea of what your book will be about

7. Hockey coaches develop game plans and strategies to help their team succeed.

8. Leukemia research continues to improve our understanding of the disease and develop more effective treatments.

9. Mathematics helps develop critical thinking and problem-solving skills.

10. Pets, including dogs, can help children develop empathy and responsibility.

11. The scientific community is working to develop sustainable energy sources to combat climate change.

12. The success of Tesla has had a significant impact on the automotive industry, inspiring other automakers to invest in electric vehicle technology and develop their own electric models.

13. Ultimately, a father is an important figure in a child's life, providing love, support, and guidance as they grow and develop into adulthood.

14. Viruses have been used in genetic engineering and biotechnology to develop new therapies and treatments.

15. While the advanced countries in America and Europe have the wealth and scientific know-how to produce solar and nuclear energy on a commercial scale, the poorer Asiatic countries like India, Pakistan, and Bangladesh may develop an energy source by bio-gas-developing machines

Random Sentences

1. Hindi niya gustong maging nag-iisa sa buhay.

2. The little girl dressed up as a pretty lady for Halloween.

3. Electric cars can provide a more connected driving experience through the integration of advanced technology such as navigation systems and smartphone apps.

4. Ilan ang silya sa komedor ninyo?

5. Cancer can be prevented through healthy lifestyle choices, such as regular exercise, a balanced diet, and avoiding tobacco and excessive alcohol consumption.

6. Oh bakit nandito ka pa? ani Maico bilang tugon.

7. Sa pagkain ng pulotgata, mahalaga na maghugas ng kamay upang hindi magkalat ang tamis sa ibang bagay.

8. Min erfaring har lært mig, at det er vigtigt at have en god arbejdsetik.

9. Mathematics is the study of numbers, quantities, and shapes.

10. Nagsisilbi siya bilang abogado upang itaguyod ang katarungan sa kanyang kliyente.

11. Gracias por creer en mí incluso cuando dudaba de mí mismo/a.

12. La tos puede ser causada por una variedad de factores, incluyendo alergias, infecciones y enfermedades pulmonares.

13. Este plato tiene un toque picante que lo hace especial.

14. Nasa gitna ng kagubatan kaya hindi mo maiiwasang humalinghing nang malalim.

15. Pinangaralan nila si Tony kung gaano kahalaga ang isang ama

16. Siempre me preocupo demasiado por las cosas, pero debería recordar que "que sera, sera."

17. Inakalang ligtas ang lugar, pero may paparating palang bagyo.

18. Drømme og håb kan drive os fremad i livet.

19. Walang ka kwenta-kwenta ang palabas sa telebisyon.

20. Sa loob ng bilangguan ay doon rin niya nakilala ang isang pari, si Padre Abene

21. Está claro que la situación ha cambiado drásticamente.

22. Kehidupan penuh dengan tantangan yang harus dihadapi setiap orang.

23. The United States has a system of representative democracy, where citizens elect representatives to make decisions on their behalf

24. Pangkaraniwang Araw sa Buhay ng Isang Tao

25. Bilin ni Aling Pising na lagi niyang aayusin ang kaniyang buhok upang hindi maging sagabal sa kaniyang mga gawain at pag-aaral.

26. Sa takip-silim, nakakapagbigay ng magandang silip sa mga bituin at buwan.

27. Madalas na mayroong mga organisasyon na nagsusulong ng kapayapaan at pagtigil ng digmaan.

28. Las vacaciones de invierno son un momento para descansar y pasar tiempo en familia.

29. Eine Inflation kann die wirtschaftliche Ungleichheit verschärfen, da Menschen mit niedrigerem Einkommen möglicherweise nicht in der Lage sind, mit den steigenden Preisen Schritt zu halten.

30. Nais niyang mag-iwan ng sulat para sa kanyang mahal.

31. Governments and financial institutions are exploring the use of blockchain and cryptocurrency for various applications.

32. Ano-ano ang mga sangkap ng iyong spaghetti?

33. Ang bansa ay dapat lagi nating isipin, hindi lamang ang ating sariling interes.

34. La guerra contra las drogas ha sido un tema polémico durante décadas.

35. Isang Saglit lang po.

36. Malikot ang kanyang mga mata nang siya'y bumangon at itukod ang mga kamay sa semento.

37. Hindi niya iningatan ang kanyang cellphone, samakatuwid, nasira ito agad.

38. I usually like to tell a joke to break the ice at the beginning of a presentation.

39. Kapag ako'y nasa eroplano, natatanaw ko ang iba't ibang mga pook sa ibaba.

40. Tumayo na sya, Ok! I'll be going now, see you tomorrow!

41. Omelettes are a popular choice for those following a low-carb or high-protein diet.

42. Paliparin ang kamalayan.

43. Ang daming labahin ni Maria.

44. Ang maalikabok at baku-bakong lansangan ng Nueva Ecija ay kanyang dinaanan.

45. Ang Chinese New Year ay nagpapahayag ng pag-asa at pagbabago para sa bagong taon.

46. Los sueños nos inspiran a ser mejores personas y a hacer un impacto positivo en el mundo. (Dreams inspire us to be better people and make a positive impact on the world.)

47. En tung samvittighed kan nogle gange være et tegn på, at vi har brug for at revidere vores adfærd eller beslutninger.

48. Dahil sa pagod, naupo ang matanda sa ilalim ng nasabing puno upang makapagpahinga.

49. Seeing a favorite band perform live can create a sense of euphoria and excitement.

50. Eksport af fødevarer fra Danmark er en vigtig del af landets økonomi.

Similar Words

developedbio-gas-developingdevelopment

Recent Searches

developreadskillfallareleasedsimplengfourbringslavehealthierremainleorobinhoodnapaagaonlinegusalipaghaharutantiketnaabutansaan-saannanghihinasumanginternacionalplanevilprogrammingnakapaligidinakilaynagnakawkategori,dyosabumalikgovernorsfilmsmagpasalamatibinalitanggreatcrameprutasconspecializedpowersloanskagalakannakangisingbagopa-dayagonalporgayaeconomybuhokobstaclesdercrazyyonyoungareaeksaytedtrenjerryminutemalinispasancadenafridayspecialobservation,sabisagotglobalisasyonpagmamaneholabing-siyamnapakagagandaparehongpagtangiskulunganpambahaykagipitanpaglulutoninanaisyoutube,ibinubulongmoviespagsasalitanaglalakadnakakitapakibigyannagyayanghagdananlolapamagattotookaninatusongmasukolannikakamotebesesmagtanimtsonggolumiitbasketballunconstitutionaltiniklingsilamaghahandanahulaansapilitangganangkargangviewslucykumukuloituturoheartbreaklivesnegosyokinsenag-away-awaybrightcalciummodernealexandernagdaramdamrailwaysgivekablanimpactodyiptsexixcombinedalaalamejoipanlinispeeporugafakewowabalasearchpancitrawkapilingimpacteddevelopmentsupportmitigatestreamingconservatoriosnabitawandadalhinnyenumerososvedvarendeherramientasannadiferentesnalalabingsuccessdisposalkundiablecigarettesmagkabilanganilakwebaetosyncarayagilitypointnakatayopresence,susulitadicionalesnatatakotkumaripasbalitasettingeditorpaaaddresstulisanuniversityhulihaninakalapakanta-kantangrevolucionadoadvertising,namumulotnakikiapagkagustonaiyakkalakio-orderperwisyorememberedmanager