Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "panatag"

1. Mabait ang pamilya ni Aling Juana kaya panatag ang loob ng ama't ina ni Bereti.

Random Sentences

1. Mahigit sa walong oras siyang nagtatrabaho araw-araw upang matustusan ang kanyang mga pangangailangan.

2. La publicidad en línea ha permitido a las empresas llegar a un público más amplio.

3. Eine klare Gewissensentscheidung kann uns helfen, unser Leben in Einklang mit unseren Überzeugungen zu leben.

4. Many people experience stress or burnout from overworking or job dissatisfaction.

5. Nous avons eu une danse de mariage mémorable.

6. Tumawa rin siya ng malakas, How's Palawan? tanong niya.

7. They are a member of the National Basketball Association (NBA) and play in the Western Conference's Pacific Division.

8. I met a beautiful lady on my trip to Paris, and we had a wonderful conversation over coffee.

9. Dahil sa mabuti niyang pagtuturo, naging interesado ako sa agham at naging guro rin ako.

10. Hinintay lamang niya ang aking pagdating.

11. The President is elected every four years through a process known as the presidential election

12. My daughter made me a homemade card that said "happy birthday, Mom!"

13. In theater, "break a leg" is a way of wishing someone good luck without actually saying it.

14. Gusto ko na talaga mamasyal sa Singapore.

15. Natutuwa ako kapag nakakakita ako ng isang halamanang mayabong sa mga pampublikong lugar.

16. May anak itong laging isinasama sa paglalaba.

17. The little girl dressed up as a pretty lady for Halloween.

18. La menta es una hierba refrescante que se utiliza en bebidas y postres.

19. Der er forskellige identiteter inden for transkønnethed, herunder non-binær og genderfluid.

20. Vielen Dank! - Thank you very much!

21. The invention of the telephone can be traced back to Alexander Graham Bell, who is credited with patenting the first practical telephone in 1876

22. L'intelligence artificielle peut être utilisée pour identifier les anomalies dans les données pour prévenir les problèmes futurs.

23. Pagkatapos ay abut-abot ang kanyang paghingi ng paumanhin sa mga duwende.

24. Ang takip-silim ay isang panahon kung saan maaari mong maappreciate ang ganda ng kalikasan at ng mga gusali.

25. A portion of the company's profits is allocated for charitable activities every year.

26. Einstein was offered the presidency of Israel in 1952, but declined the offer.

27. Sang-ayon ako na kailangan nating magkaroon ng malakas na liderato upang umunlad ang ating bansa.

28. Don't spill the beans about the project, it's supposed to be a secret.

29. Binigyan niya ako ng aklat tungkol sa kasaysayan ng panitikan ng Asya.

30. Maraming bagay ang kailangan isaalang-alang sa pagpaplano ng kasal, tulad ng budget at mga bisita.

31. Sa katagalan, natanggap na niya ang panunuksong ito.

32. Anong nangyari sayo? Bakit hinde ka nagkakakain?

33. He is not taking a photography class this semester.

34. Ang snob naman neto. Alam mo ba kung anong oras na?

35. Les enseignants doivent collaborer avec les parents et les autres professionnels de l'éducation pour assurer la réussite des élèves.

36. Ang digmaan ay maaaring magdulot ng mga trauma at sakit sa mga biktima at kalahok.

37. Las heridas pueden ser causadas por cortes, abrasiones o quemaduras.

38. Ariana first gained fame as an actress, starring as Cat Valentine on Nickelodeon's shows Victorious and Sam & Cat.

39. Ang kaniyang dugo ay nakakagaling ng mga sakit.

40. The flowers are blooming in the garden.

41. The Wizard of Oz follows Dorothy and her friends—a scarecrow, tin man, and lion—as they seek the wizard's help to find their true desires.

42. Tila hindi siya sang-ayon sa naging desisyon ng grupo.

43. Wala akong pakelam! Dapat sayo pinapalo!

44. Magkano ang bili mo sa iyong cellphone?

45. Omelettes are a popular choice for those following a low-carb or high-protein diet.

46. Nagpunta ako sa may lobby para magisip.

47. Pupunta ako sa Madrid sa tag-araw.

48. Foreclosed properties may have liens or other encumbrances, which can complicate the purchase process.

49. Napakalungkot ng balitang iyan.

50. The teacher explains the lesson clearly.

Recent Searches

maestramaligayapanatagmakausapescuelassabongaayusin11pmmaya-mayaakmanghinagisnobodynabigaymaibatamaandesarrollaronipinabalotturongasmenpokerhinukaymalasutlabantulottataaskatagangadvertisingnakakapuntalilipadsahodmabiroinventadopakisabicareerupuansumimangotbutasnapalakasinintaynatulakganuntilicalidadanumanmataaascompletamenteklasengmagigitingsusiskyldeskapainkuwebapusapeppybigongdumilimforstånegosyoiyakpagsisimbangtindigkahoymakehopeosakahmmmmangepasigawsonidoairconsumuotmatulischarismatickananmagtipidmalikotpaghusayanednapinamilipamilyatumaholtanodskypetransmitidasmadurassinumangmininimizepriestkagandaadoptedtsakamapahamaklikesngayopagtangisprimerasulmaisramdamtuwangbutihingpetsangarbejderhehenapatingalanakasuotmapaibabawupobuwalipinabalikdevelopedperlaelectionsrailtingwidespreadkamatishearmatchingselldagapilitfatalnutrientes,maghandabeyondgenerationsbalderelativelycrossarmedguiltymetodelasaidtipidcalltruegongpagkalapitcreatememoryulodependingexistneedsflashsettingstoppilingmultoviewdividedmalapadipanliniskamiascontroversypinanawanmagkasing-edadnakataasbahagingnakaliliyongpagluluksakartongnapapadaantemparaturalungkutaroundmakangitinapakaramingyakapindilagpagdudugoreahaberkongresomunapantalongbangkangaccessdrivermedianteproductsdisseresortdiliwariwchristmaskagabiigigiitherelanagenebobotoboyapologeticconnectingfridaycampaignspapuntaclassesmasasarap