Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

32 sentences found for "together"

1. Get your act together

2. He was one of the first musicians to popularize rock and roll, and his music and style helped to break down racial barriers and bring different cultures together

3. I knew that Jennifer and I would get along well - we're both vegetarians, after all. Birds of the same feather flock together!

4. It's hard to break into a new social group if you don't share any common interests - birds of the same feather flock together, after all.

5. It's time to pull yourself together and start making positive changes in your life.

6. It's time to pull yourself together and start taking responsibility for your actions.

7. John and Tom are both avid cyclists, so it's no surprise that they've become close friends - birds of the same feather flock together!

8. Many politicians are corrupt, and it seems like birds of the same feather flock together in their pursuit of power.

9. My brother and I both love hiking and camping, so we make great travel companions. Birds of the same feather flock together!

10. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

11. Pull yourself together and focus on the task at hand.

12. Pull yourself together and let's figure out a solution to this problem.

13. Pull yourself together and show some professionalism.

14. Pull yourself together and stop making excuses for your behavior.

15. Scissors are a cutting tool with two blades joined together at a pivot point.

16. Stop crying and pull yourself together, we have work to do.

17. The conference brings together a variety of professionals from different industries.

18. The members of the knitting club are all so kind and supportive of each other. Birds of the same feather flock together.

19. The team is working together smoothly, and so far so good.

20. The tech industry is full of people who are obsessed with new gadgets and software - birds of the same feather flock together!

21. They are cooking together in the kitchen.

22. They are not cooking together tonight.

23. They are singing a song together.

24. They have been creating art together for hours.

25. They watch movies together on Fridays.

26. This is not the time to fall apart, pull yourself together and think clearly.

27. Ultimately, Christmas is a time of unity and togetherness, bringing people of all backgrounds and beliefs together to celebrate the spirit of love and hope.

28. We have been cooking dinner together for an hour.

29. When I arrived at the book club meeting, I was pleased to see that everyone there shared my love of literary fiction. Birds of the same feather flock together indeed.

30. When I saw that Jake and his friends all had tattoos and piercings, I thought they might be a rough crowd - birds of the same feather flock together, right?

31. You need to pull yourself together and face the reality of the situation.

32. You're stronger than this, pull yourself together and fight through the tough times.

Random Sentences

1. Foreclosed properties can be a good option for those who are looking for a vacation home or second property.

2. Il n'y a pas de méthode unique pour maintenir la motivation, car chaque individu est différent et doit trouver ce qui fonctionne le mieux pour lui.

3. Ganun ba? Sige samahan na lang muna kitang maghintay dito.

4. Ayaw ko ng masyadong maanghang/matamis.

5. Weddings are typically celebrated with family and friends.

6. Sopas ang ipinabalik ko sa waiter.

7. Tumigil muna kami sa harap ng tarangkahan bago pumasok sa simbahan.

8. Sa oras na makaipon ako, bibili ako ng tiket.

9. Cultivar maíz es un proceso muy gratificante, ya que el maíz es una de las principales cosechas en todo el mundo

10. El perro ladrando en la calle está llamando la atención de los vecinos.

11. Pahiram ng iyong cellphone, nawala ang aking battery.

12. Oh Aya, napatawag ka? mejo bagsak ang boses ko.

13. May klase ako tuwing Lunes at Miyerkules.

14. Hindi maunawaan ni Bereti ngunit eksayted siya sa buhay nina Karing.

15. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

16. Las escuelas también ofrecen programas de apoyo, como tutorías y asesoramiento académico.

17. Nasa harap ako ng istasyon ng tren.

18. Mabuti pa roon, kahit nakabilad sa init.

19. Maundy Thursday is the day when Jesus celebrated the Last Supper with his disciples, washing their feet as a sign of humility and love.

20. The acquired assets will give the company a competitive edge.

21. Hockey players must have good hand-eye coordination, as well as strong stick-handling and shooting skills.

22. Gusto ko sanang ligawan si Clara.

23. Ipinakita ng dokumentaryo ang mga kaso ng abuso sa mga nakakulong na bilanggo.

24. Overall, money plays a central role in modern society and can have significant impacts on people's lives and the economy as a whole.

25. Les entreprises cherchent souvent à maximiser leurs profits.

26. Maria, si Ginang Cruz. Guro ko siya.

27. Dadalo si Trina sa workshop sa Oktubre

28. Samantala sa malayong lugar, nagmamasid siya ng mga bituin sa kalangitan.

29. My name's Eya. Nice to meet you.

30. Ang kasamaan ng anak ay kaya pa nilang pagtiisan ngunit ang paglalait at paghamak sa kanila bilang magulang ay hindi na niya mapalampas.

31. Nagbabaga ang mga damdamin ng magkasintahan habang nag-aaway sila.

32. Ang tubig-ulan ay nagbibigay ng natural na tubig sa mga lawa at ilog, na nagbibigay ng tahanan at pagkain sa mga isda.

33. Hang in there and don't lose hope - things will turn around soon.

34. Emma Stone won an Academy Award for her role in the film "La La Land" and has appeared in movies like "The Help" and "Easy A."

35. Malapit ang eskuwela ko sa bahay namin.

36. I can't keep it a secret any longer, I'm going to spill the beans.

37. Ang mga ideya ni Rizal tungkol sa pagkakapantay-pantay, edukasyon, at pagkakaisa ay patuloy na nagbibigay-inspirasyon sa mga Pilipino.

38. Kapag hindi tama ang timpla ng pulotgata, maaaring maging mapakla o mapait ito.

39. Ang sundalo ay nangahas na tumayo sa gitna ng labanan upang iligtas ang isang sugatang kasama.

40. Makalipas ang siyam na buwan, isinilang ang isang napakalusog na batang babae.

41. Les hôpitaux sont équipés pour fournir des soins d'urgence aux patients.

42. Maaaring magdulot ng agam-agam ang mga suliraning pang-ekonomiya tulad ng kahirapan at pagtaas ng presyo ng mga bilihin.

43. Sa dagat, natatanaw ko ang mga ibon na lumilipad sa malawak na kalangitan.

44. Si Datu Duri ay matandang-matanda na.

45. The company decided to avoid the risky venture and focus on safer options.

46. I am absolutely excited about the future possibilities.

47. He has traveled to many countries.

48. Ngayon ka lang makakakaen dito?

49. Ang mga kundiman ay patunay na ang pag-ibig ay may lakas na magdulot ng ligaya at kalungkutan.

50. Mas maganda pa ring magpatawad kaysa magtanim ng inis sa puso.

Recent Searches

pulaisasciencetogetherdemocraticmarsoouesaringdedication,picsthentinanggalpartaddreportipinaobstaclesagilitytuwideksenawalletencounterbusinalisdragongitanasincludedoesblessmaratingremotecontrolledrawbadingaidmind:flyfiguremarurusingmahiwaganapakahangakagandahagrevolutioneretrequiresestudyanteiintayinitinakdangpamanklimaevenintensidadmakapalagmagkaharapnaliwanagannakitafranciscosakyanhinukaysinisiubomarketing:waiterpumuntakahariannangyaritumaposwellbrucemungkahimagpa-ospitalnanahimiknagkasakitbukastahimikusuarioitinapontusindvisnamalagipananakittransportationseniorisinagottherapyburmamagbungasumarapchefendngunitlazadalumikhapinagkaloobanracialtayodumikitpagkuwamagta-taxinamumukod-tangicapitalistsapagkatmahigithalikapinagkasundonakaakyatshiftnabahalakaygovernorspahahanapyunwalismatagumpaypasyapagitantilaipinikitbakuraniboninaaminopportunitynangangalitforskel,pinasalamatanromanticismomakatatlobusinessesmagtataasmalapitanmatamanphilippineyorksumpainmaubosdisenyokasuutanhastapagbabagong-anyopagkakatayokalalakihankawili-wilituladpinapakiramdamannakaka-inibinubulongmagkasintahansportslumalangoynagre-reviewnagtitiisgobernadorbellnagmistulangaktibistapagkalitopupuntahannag-poutpamilihanglobalisasyonnegosyanteentrancepamasahelumibotkinalalagyanmagkasamalinggongmakasalanangkumalmahayaanumuwimorningargueejecutandreamnagbibirokuwentointramurosmagdamagpakinabangandistanciakilongmaghahabilalabaspinangaralanmakilalatanghalitiyakmaghilamosisinusuottinuturoisusuotbakanteteachingscreditagostoshadestsonggokapwaexigentejulietbarreras