Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

32 sentences found for "together"

1. Get your act together

2. He was one of the first musicians to popularize rock and roll, and his music and style helped to break down racial barriers and bring different cultures together

3. I knew that Jennifer and I would get along well - we're both vegetarians, after all. Birds of the same feather flock together!

4. It's hard to break into a new social group if you don't share any common interests - birds of the same feather flock together, after all.

5. It's time to pull yourself together and start making positive changes in your life.

6. It's time to pull yourself together and start taking responsibility for your actions.

7. John and Tom are both avid cyclists, so it's no surprise that they've become close friends - birds of the same feather flock together!

8. Many politicians are corrupt, and it seems like birds of the same feather flock together in their pursuit of power.

9. My brother and I both love hiking and camping, so we make great travel companions. Birds of the same feather flock together!

10. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

11. Pull yourself together and focus on the task at hand.

12. Pull yourself together and let's figure out a solution to this problem.

13. Pull yourself together and show some professionalism.

14. Pull yourself together and stop making excuses for your behavior.

15. Scissors are a cutting tool with two blades joined together at a pivot point.

16. Stop crying and pull yourself together, we have work to do.

17. The conference brings together a variety of professionals from different industries.

18. The members of the knitting club are all so kind and supportive of each other. Birds of the same feather flock together.

19. The team is working together smoothly, and so far so good.

20. The tech industry is full of people who are obsessed with new gadgets and software - birds of the same feather flock together!

21. They are cooking together in the kitchen.

22. They are not cooking together tonight.

23. They are singing a song together.

24. They have been creating art together for hours.

25. They watch movies together on Fridays.

26. This is not the time to fall apart, pull yourself together and think clearly.

27. Ultimately, Christmas is a time of unity and togetherness, bringing people of all backgrounds and beliefs together to celebrate the spirit of love and hope.

28. We have been cooking dinner together for an hour.

29. When I arrived at the book club meeting, I was pleased to see that everyone there shared my love of literary fiction. Birds of the same feather flock together indeed.

30. When I saw that Jake and his friends all had tattoos and piercings, I thought they might be a rough crowd - birds of the same feather flock together, right?

31. You need to pull yourself together and face the reality of the situation.

32. You're stronger than this, pull yourself together and fight through the tough times.

Random Sentences

1. Pumunta kami sa Cebu noong Sabado.

2. Il est important de connaître ses limites et de chercher de l'aide si l'on rencontre des problèmes liés au jeu.

3. Algunas plantas son comestibles y se utilizan en la alimentación, como las frutas y verduras.

4. Nagbigay ng kanyang opinyon ang eksperto ukol kay President Bongbong Marcos

5. Jouer de manière responsable et contrôler ses habitudes de jeu est crucial pour éviter des conséquences graves.

6.

7. Ang yaman pala ni Chavit!

8. Kung anong puno, siya ang bunga.

9. Kapag may isinuksok, may madudukot.

10. Kehidupan penuh dengan tantangan yang harus dihadapi setiap orang.

11. Viruses have been used in genetic engineering and biotechnology to develop new therapies and treatments.

12. Huwag magmadali, namnamin mo ang proseso ng pagkatuto.

13. Ang mga anak-pawis ay nangangailangan ng patas na pagkakataon upang magkamit ng tagumpay at umangat sa buhay.

14. Medarbejdere kan opnå ekstra fordele som bonusser eller tillæg for deres fremragende arbejde.

15. Nang magbago ang mga pangyayari at matanggap ko ang mga kaganapang hindi ko inaasahan, ang aking pagkabahala ay napawi.

16. Tanah Lot di Bali adalah sebuah pura Hindu yang terletak di atas karang dan menawarkan pemandangan laut yang indah.

17. Musk has been at the forefront of developing electric cars and sustainable energy solutions.

18. Kumaripas ng lakad ang matanda nang bumilis ang ulan.

19. Dalhan ninyo ng prutas si lola.

20. Sa pamamagitan ng pag-aaral ng mga relihiyon, mas naging bukas ang aking kamalayan sa iba't ibang paniniwala.

21. Inutusan nga lang ho niya kong bumili ng ulam, para mamayang tanghali.

22. Einstein was a member of the Institute for Advanced Study at Princeton University for many years.

23. Bilang paglilinaw, hindi ako nagsabi na aalis ako, kundi lilipat lang ako ng departamento.

24. Halos gawin na siyang prinsesa ng mga ito.

25. Nasa unibersidad si Clara araw-araw.

26. La escultura de Leonardo da Vinci nunca fue tan famosa como su pintura.

27. Omelettes are a popular choice for those following a low-carb or high-protein diet.

28. Ate Annika naman eh, gusto ko ng toy!

29. Kina Lana. simpleng sagot ko.

30. Tulala siyang tumitig sa malawak na tanawin ng dagat.

31. ¡Muchas gracias!

32. Uncertainty can create opportunities for growth and development.

33. The legend of Santa Claus, a beloved figure associated with Christmas, evolved from the story of Saint Nicholas, a Christian bishop known for his generosity and kindness.

34. Talaga? aniya. Tumango ako. Yehey! The best ka talaga!

35. Después de desayunar, salgo a correr en el parque.

36. Baby fever can affect people of various ages, backgrounds, and genders.

37. Tantangan hidup juga dapat mengajarkan kita tentang nilai-nilai seperti kesabaran, rasa syukur, dan ketekunan.

38. Sí, claro, puedo confirmar tu reserva.

39. Ang sugal ay isang mapanlinlang na paraan ng pag-asang maaaring magdulot ng pagkabigo at pagkasira sa buhay.

40. Ang pag-asa ay nagbibigay ng motibasyon sa mga tao upang magpatuloy sa kanilang mga pangarap at mga layunin sa buhay.

41. Il est important de se fixer des échéances et de travailler régulièrement pour atteindre ses objectifs.

42. El nuevo libro de la autora está llamando la atención de los lectores.

43. Stocks and bonds are generally more liquid than real estate or other alternative investments.

44. Cooking at home with fresh ingredients is an easy way to eat more healthily.

45. Bakit nga ba niya papansinin si Ogor?

46. Dahil sa biglaang trapik, na-late ako sa meeting ko kanina.

47. Nakagagamot ng diyabetis ang halamang ito.

48. Ngunit may isang bata ang may bulate kaya lagi siyang walang gana.

49. Hiram lamang natin ang ating buhay sa Diyos.

50. The popularity of coffee has led to the development of several coffee-related industries, such as coffee roasting and coffee equipment manufacturing.

Recent Searches

manamis-namistogetheradaptabilityhinagud-hagodhumalakhaksiraskillhomeworkmanlalakbaykingdommakikipaglaropinagpatuloygayundinnakangisingnasiyahaninformationnagbiyayahappykanluranumuwinglumampaspiyanoawitansumasaliwpabilitinikmaneksenakirbynakaangatnapatingala1960svedvarendenagpaiyakmagsubomakabaliklunasnatalomaluwagkaninaitinaaskarapatangmalakingayonumaapawlutonangumbidagenerabaresortisipbranchomgkapamilyahumarapgubatbooksabut-abothoneymoonkamustaunidostinahakinuulampabulongiwanpropensobilanginrosapagbabantaiiwasanika-50umiibigmagselosginawangimbesuntimely1970spootyeplapitantelangkerbeventsnakakitaahasdistansyaclockmaipantawid-gutomnaglinisminuteenfermedades,pinahalatamarchpagkuwaduguannakalipaspagsasalitapagpapautangmakalaglag-pantybaku-bakongartisttuluyanpagkaraakahaponnecesarionangangaralnakaririmarimmalulungkotmakakakainpambatangmakikitulogmakinangarbejdsstyrkeitinatapatbalediktoryanmitigatebanlagdisciplinnaramdampositibomagalangmatangkadnagpaalamlawaydelserengkantadanangingitngitinilabasnilayuannagitlaidiomakatipunananubayaniatfe-commerce,casaaaisshtagalogbobotodulotcoinbase1940ipanlinismodernemaalogrhythmmatchingkasamainisprovideginisingdontbubonginfluentialpasswordstoremeannothingbeginningviewsbehalfconstitutionpinilinghatingkauntiqualityoveralldinalaspeechyoncornertiposmovingshareapolloactionipongmurang-murakumukuhaboxsamaipagtimplaforskel,pagsidlannag-oorasyonpunong-kahoygayunpamannakakadalawpotaenanakapagngangalitlaki-lakikarwahengbusinessesnakapagreklamonaninirahanetonapasigawnapipilitaninterestkaharianatensyonglibing