Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "dumilim"

1. Nalungkot ang Buto nang dumilim na ang paligid.

Random Sentences

1. Vi bør fejre og ære vores helte, så de ved, at deres indsats bliver værdsat.

2. Lazada has expanded its business into the logistics and payments sectors, with Lazada Express and Lazada Wallet.

3. They are cooking together in the kitchen.

4.

5. Paglingon ko, nakita kong papalapit sakin si Lory.

6. Sehari di negeri sendiri lebih baik daripada seribu hari di negeri orang.

7. Protecting the environment involves preserving natural resources and reducing waste.

8. Kapag mayroon kang kaulayaw, hindi ka mag-iisa sa mga pagsubok na iyong kinakaharap.

9. He used his good credit score as leverage to negotiate a lower interest rate on his mortgage.

10. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

11. Mahal na mahal ng ama't ina si Ranay.

12. Sa sobrang lamig ng tubig, hindi ko magawang salatin ito nang matagal.

13. The hockey rink is divided into three zones, with each team playing offense and defense alternately.

14. Ilan ang tao sa silid-aralan?

15. Pinarusahan ang empleyado na na-suway sa patakaran ng kumpanya.

16. Bibili rin siya ng garbansos.

17. Ang mga anak-pawis ay nagtatrabaho sa iba't ibang sektor ng ekonomiya, tulad ng agrikultura at pagmimina.

18. Tumaba sila ng tumaba hanggang sa tuwing maliligo kahit na pa tatlong tao lang sa sapa ay umaapaw agad tubig.

19. Sa pagdaan ng panahon, yumabong ang kultura ng pagbibigay ng regalo tuwing Pasko.

20. Nasa park sila at pinagmamasdan niya ang mga bata na naglalaro sa paligid.

21. Proses kelahiran di Indonesia umumnya dilakukan di rumah sakit atau pusat kesehatan masyarakat (Puskesmas).

22. Algunas culturas consideran a las serpientes como símbolos de sabiduría, renacimiento o incluso divinidad.

23. The scientific study of astronomy has led to new insights into the origins and evolution of the universe.

24. Masarap ang bawal.

25. Jouer de manière responsable et contrôler ses habitudes de jeu est crucial pour éviter des conséquences graves.

26. But the point is that research in the field of the development of new energy sources must be carried on further and expedited so that the exhaustion of conventional sources of power does not adversely affect the growth of our economy and the progress of civilization

27. I am not reading a book at this time.

28. No puedo controlar el futuro, así que "que sera, sera."

29. Pasensya na, kailangan ko umalis ng maaga.

30. Mahirap magsalita nang diretsahan, pero may gusto ako sa iyo.

31. Scientific research has shown that meditation can have a positive impact on mental health.

32. Read books on writing and publishing, it will help you to gain knowledge on the process and best practices

33. The transmitter and receiver were connected by a network of wires, which allowed the signals to be transmitted over long distances

34. The bride looked stunning in her wedding dress, truly a beautiful lady.

35. Frustration can be a sign that we need to reevaluate our approach or seek alternative solutions.

36. La amistad entre ellos se fortaleció después de pasar por una experiencia difícil.

37. Musk is known for his ambitious goals and his willingness to take on seemingly impossible challenges.

38. Kapag ang tao ay may tiyaga, kahit maliit na bagay ay may tagumpay.

39. La falta de acceso a tierras y recursos puede ser un desafío para los agricultores en algunas regiones.

40. Leonardo da Vinci diseñó varios inventos como el helicóptero y la bicicleta.

41. Las escuelas también pueden tener una biblioteca y recursos educativos en línea para los estudiantes.

42. The amount of knowledge that exists in the world is immeasurable.

43. La conciencia es una herramienta importante para tomar decisiones éticas y morales en la vida.

44. A couple of lovebirds were seen walking hand-in-hand in the park.

45. ¿Cuántos años tienes?

46. Pinagpalaluan si Maria ng kanyang mga kapatid dahil sa kanyang sipag at tiyaga.

47. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

48. Ang magnanakaw ay nakunan ng CCTV habang papalapit ito sa tindahan.

49. Kapag nalulong ka na sa droga, mahirap nang makalaya sa hawla nito.

50. Nagpunta ako sa may kusina para hanapin siya.

Recent Searches

pinatiradumilimsalamangkerosiniyasatpsssboracayhahahaestasyonmakapalmukhanangangakoaplicacioneskinasisindakansinundanabanganpagkatjuanbukasnobodykumanta1970swidelyiskedyulmayahumblepedromamimagdasumalascheduleaggressionhellokapitbahaynglalabatungkodkawayanmagsalitauusapanwayspagtatanghalgumalamakasalanangmasyadongamuyinkaratulangpisaratagaytayhouseholdbaryofavorpanunuksotumitigilpananimginilingdumapanapadpadnakapikitfewmalabohmmmmasarapcontroversyrepresentedmarkedsekonomiginamagtanimhumpaynapakaofreceninangmagbabakasyonleadinglikesmangenag-aaralanaksinumangbironakakunot-noongmag-iikasiyamlalabhancomplexmaglalabing-animpyestalimosfinalized,shininghinding-hindikategori,nakakapamasyalpamahalaananibersaryonagmakaawaeskwelahankinauupuangnapakalusogpananglawyumuyukotumulaknarinigkuwentomagagamitnaglokohanpistainfinityulocolourmakatawabahagyangdiagnosesdinalawexpertdidcuriousfriesefficientinsteadkapilingformatginawaparostyrertherapeuticsnewsnaguusapsisikattrentaipinauutanglungsodnatanongbinentahantumapostinuturosuhestiyonniyonnakaliliyongmahabangiyongreaksiyonleksiyonaksiyontravelerinteriorkahitisinisigawkagubatanmayakapmagnanakawisasabadkabuntisannagpalipatbehaviorpinanoodrefipaalambituinabenanahuliviewpalipat-lipatmassesfaultcomputereiponghistorypagkakayakapnakabuklatangkingnakatalungkostudiedultimatelylikelyipinasyangfistsjerryinspiredfriendsbarexpertiseateosakaubuhinmaalogamodeteriorateandamingbitawanmaskdeathblusanagbungaadangpisosukatconnectiontransitbasahinmegetpersonalkagustuhang