Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

16 sentences found for "only"

1. "A dog is the only thing on earth that loves you more than he loves himself."

2. "A dog is the only thing that can mend a crack in your broken heart."

3. Besides, smoking cigarettes means a waste of money, since the habit instead of doing any good only causes injury to one’s health and makes one a slave to the addiction

4. But all this was done through sound only.

5. Cancer can impact not only the individual but also their families and caregivers.

6. Han er den eneste, jeg nogensinde har været forelsket i. (He's the only one I've ever been in love with.)

7. His invention was an improvement over earlier attempts to create a long-distance communication device, such as the telegraph, which could only transmit messages in Morse code

8. Hun er ikke kun smuk, men også en fascinerende dame. (She is not only beautiful but also a fascinating lady.)

9. James A. Garfield, the twentieth president of the United States, served for only 200 days in 1881 before his assassination.

10. My favorite restaurant is expensive, so I only eat there once in a blue moon as a special treat.

11. Not only did he crash my car, but he also tried to blame me for it. That just added insult to injury.

12. Not only that; but as the population of the world increases, the need for energy will also increase

13. Omelettes can be made using egg whites only for a healthier, lower-fat option.

14. Oscilloscopes can measure not only voltage waveforms but also current, frequency, phase, and other parameters.

15. Translation: I cannot change the past, I can only accept it with "what will be, will be."

16. William Henry Harrison, the ninth president of the United States, served for only 31 days in 1841 before his death.

Random Sentences

1. Laughter is the best medicine.

2. Pumitas siya ng bunga at pinisil ito hanggang sa lumabas ang laman.

3. Maramot ang bata sa laruan kaya walang gustong makipaglaro sa kanya.

4. Eine Inflation von 2-3% pro Jahr wird oft als normal angesehen.

5. Maraming paniki sa kweba.

6. Higupin ng basang tuwalya ang tubig sa mesa.

7. Sa pagguhit, mahalaga ang pagpili ng tamang anggulo at perspektiba.

8. Namnamin mo ang ganda ng paligid sa takipsilim.

9. Dogs can be trained for a variety of tasks, such as therapy and service animals.

10. I knew that Jennifer and I would get along well - we're both vegetarians, after all. Birds of the same feather flock together!

11. Ang pagsasawalang-bahala sa mga mensahe ng katotohanan ay nagpapakita ng pagiging bulag sa katotohanan.

12. **You've got one text message**

13. Les étudiants doivent respecter les règles de conduite à l'école.

14. Mas lumakas umano ang ekonomiya matapos buksan muli ang mga negosyo.

15. Está claro que el equipo necesita mejorar su desempeño.

16. Ang poot ang nagbibigay sa akin ng lakas at determinasyon upang harapin ang mga hamon ng buhay.

17. Nakatanggap ako ng inspirasyon sa mga kanta ng Bukas Palad sa panahon ng pandemya.

18. Naglakad kami sa gubat na mayabong ng mga punong-kahoy, at naramdaman namin ang sariwang hangin.

19. Ang pagkakaroon ng magandang asal at ugali ay mahalaga sa bawat relasyon, samakatuwid.

20. From there it spread to different other countries of the world

21. Pinaliguan ni Simon ang sanggol.

22. Les dépenses publiques peuvent avoir un impact significatif sur l'économie.

23. Maglalaba ako bukas ng umaga.

24. Nagmamadali na ako ngunit dumaan pa sa gasolinahan ang driver ng dyip.

25. Samantala sa malayong lugar, nagmamasid siya ng mga bituin sa kalangitan.

26. Nagandahan ako sa simula ng konsiyerto.

27. Ipinagtanggol ng mga obispo ang doktrina ng purgatoryo sa kanyang homiliya.

28. Ang bayanihan ay nagpapakita ng pagkakaisa at pagtutulungan sa pagharap sa mga hamon ng buhay.

29. Mabuti na lamang at hindi natuloy ang sumpa.

30. They are a great way to use up leftover ingredients and reduce food waste.

31. Dito ang mga lalaki at doon ang mga babae.

32. Gracias por darme la oportunidad de aprender y crecer.

33. Sa takip-silim, nakikita mo ang kagandahan ng mga kalsada dahil sa mga ilaw na nagbibigay ng magandang siluet sa mga tao.

34. I know we're behind schedule, but let's not cut corners on safety.

35. The team lost their momentum after a player got injured.

36. Nakakatuwang malaman na maraming kabataan pa rin ang nakikinig at nakakatuklas ng kagandahan ng mga kanta ng Bukas Palad.

37. Ok lang.. iintayin na lang kita.

38. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

39. Anong pangalan ng lugar na ito?

40. Ibinigay ko ang aking panalangin at dasal para sa mga nangangailangan ng tulong.

41. The transmitter and receiver were connected by a network of wires, which allowed the signals to be transmitted over long distances

42. Walang konsyerto sa plasa mamayang gabi.

43. Si Rizal ay isang maalam na mag-aaral na nag-aral sa Unibersidad ng Santo Tomas, Unibersidad ng Madrid, at Unibersidad ng Heidelberg.

44. Environmental protection is not a choice, but a responsibility that we all share to protect our planet and future generations.

45. Nasuklam ako kay Pedro dahil sa ginawa niya.

46. Sa kasalukuyang panahon ang bayabas, bukod sa ito ay kinakain o pagkapitas sa puno, ito rin ay ipinansasahog sa ating mga lutuin.

47. I am not working on a project for work currently.

48. Sumakay ako ng taksi papuntang airport.

49. En la realidad, las cosas no son siempre en blanco y negro.

50. The city is home to iconic landmarks such as the Hollywood Sign and the Walk of Fame.

Recent Searches

interiorrobertsambitonlyviewshimsecarsebabeipongresourcescuandovisualstringdoesmarasigansetslargelasingflashbinilingoftenipinalitumalisdatingjustinpagkakalutomatutuwayumuyukopinangalananteacherflamenconaiwanalintuntuninbisigbeautifulhissquashculturagayundinkumukuhapoliticalnatitiyakibonnageespadahannagpepekeisulatmahihirapmanghikayatmagsi-skiingpinapasayaliv,nakadapanagbabakasyongovernorskinagalitannaguguluhangmahawaankonsultasyonnagkasunogtinulak-tulaknagtitindatinaasannakatunghaypagsisisitinakasanpagkainiskapasyahankumikilosnagdiretsomagkaharapnabighanikasiyahannakapasoknakuhadeliciosanasahodsinusuklalyannagtataelinggongtutungona-fundnangyarikongresonapasubsobnaglokotag-ulanisinakripisyoconstitutionlalotulisankakilalakaninotuktokmakaiponmaghaponnakalocknagbentapoongkabiyaklumabasnobodypinabulaandurantereorganizingmagpakaramina-curioustsonggomaskinernagbagokasamaangpapuntangkumaenkanayanggawabibigyansakopnangingitngitnatakotnagplaysakyanmakakaaustraliaaanhinmatangkadclassroomiyakmagdaantengabulongkenjiexpeditedluneskasama3hrsumibiganumanpatawarinlungkotmeronaminstoflavioskyldeshikingstocksadditionally,nahigaangaltibigbigongisaacipinadalamangingisdakwebaiatfbaropresyopatidiscovereddyippalaykalakingmejorektanggulomulikalansusunduinpagbahingjackydalandansubjectchavitproperlydiamondabonokahittagalogdumatingbadhoweverfariniskararatingventaspaghettibranchespyestapedewalngbalakmaaliwalasstartedreadinaapieitheranimwhyipagtimplapotentialnating