Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

16 sentences found for "only"

1. "A dog is the only thing on earth that loves you more than he loves himself."

2. "A dog is the only thing that can mend a crack in your broken heart."

3. Besides, smoking cigarettes means a waste of money, since the habit instead of doing any good only causes injury to one’s health and makes one a slave to the addiction

4. But all this was done through sound only.

5. Cancer can impact not only the individual but also their families and caregivers.

6. Han er den eneste, jeg nogensinde har været forelsket i. (He's the only one I've ever been in love with.)

7. His invention was an improvement over earlier attempts to create a long-distance communication device, such as the telegraph, which could only transmit messages in Morse code

8. Hun er ikke kun smuk, men også en fascinerende dame. (She is not only beautiful but also a fascinating lady.)

9. James A. Garfield, the twentieth president of the United States, served for only 200 days in 1881 before his assassination.

10. My favorite restaurant is expensive, so I only eat there once in a blue moon as a special treat.

11. Not only did he crash my car, but he also tried to blame me for it. That just added insult to injury.

12. Not only that; but as the population of the world increases, the need for energy will also increase

13. Omelettes can be made using egg whites only for a healthier, lower-fat option.

14. Oscilloscopes can measure not only voltage waveforms but also current, frequency, phase, and other parameters.

15. Translation: I cannot change the past, I can only accept it with "what will be, will be."

16. William Henry Harrison, the ninth president of the United States, served for only 31 days in 1841 before his death.

Random Sentences

1. Bagaimana pendapatmu tentang film yang baru saja tayang? (What is your opinion on the latest movie?)

2. Ang kahirapan at kawalan ng trabaho ay kadalasang problema ng mga anak-pawis.

3. La práctica hace al maestro.

4. Kinilig ako pero di ko pinahalata, whatever.

5. Ano bang nangyari? tanong ni Lana.

6. Pang-isahang kuwarto ang gusto niya.

7. Aray! Hinde ko naintindihan yung sinabi mo!

8. Magkano ito?

9. Andre helte arbejder hver dag for at gøre en forskel på en mere stille måde.

10. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

11. Ang pangamba ay kadalasang sanhi ng hindi pagpapakatotoo sa mga tao sa paligid natin.

12. Beauty. maya-maya eh sabi ni Maico.

13. Mababa ang antas ng tubig sa dam, kaya nagpatupad ng water rationing.

14. Puwedeng dalhin ng kaibigan ko ang radyo.

15. En helt kan være enhver, der har en positiv indflydelse på andre mennesker.

16. Lazada offers a wide range of products, including electronics, fashion, beauty products, and more.

17. Tuluy-tuloy niyang tinungo ang hagdan.

18.

19. Einstein was born in Ulm, Germany in 1879 and later emigrated to the United States during World War II.

20. Hindi ako sang-ayon sa mga kuro-kuro ng ilang mga pulitiko.

21. Mange mennesker deltager i påsketjenester i kirkerne i løbet af Holy Week.

22. Hindi mo na kailangan ang magtago't mahiya.

23. Ano ang pinabili niya sa nanay niya?

24. Les personnes ayant des motivations différentes peuvent avoir des approches différentes de la réussite.

25. Sang-ayon ako na kailangan nating magkaroon ng malakas na liderato upang umunlad ang ating bansa.

26. La música puede ser utilizada para transmitir emociones y mensajes.

27. Trump's presidential campaigns in 2016 and 2020 mobilized a large base of supporters, often referred to as "Trumpism."

28. The scientific method is used to ensure that experiments are conducted in a rigorous and unbiased manner.

29. Facebook Live enables users to broadcast live videos to their followers and engage in real-time interactions.

30. Mi novio me sorprendió con un regalo muy romántico en el Día de los Enamorados.

31. Nahulog ang saranggola sa puno ng mangga.

32. Narealize ko sa dakong huli na mahal ko pa rin ang aking ex.

33. Es importante no cosechar demasiado temprano, ya que las frutas aún pueden no estar maduras.

34. Ini sangat enak! - This is very delicious!

35. The Discover feature on Instagram suggests accounts and content based on a user's interests and interactions.

36. Gaano kalaki ang bahay ni Erap?

37. Nang umibig siya sa taga-lupang si Ramon, ang kanyang pagka-diwata'y tinalikdan niyang lubos upang mamuhay bilang ganap na tao.

38. Tesla has a strong and passionate community of supporters and customers, known as "Tesla enthusiasts" or "Teslaites."

39. Kebahagiaan sering kali tercipta melalui perspektif positif, menghargai hal-hal sederhana, dan menikmati proses hidup.

40. Hindi mo gusto ang alok na trabaho? Kung gayon, maaari kang maghanap ng ibang oportunidad.

41. Ano ang ginawa mo noong Sabado?

42. Napaluhod siya sa madulas na semento.

43. Agad siyang tumalikod at tuluy-tuloy na pumasok.

44. Martin Van Buren, the eighth president of the United States, served from 1837 to 1841 and was the first president to be born a U.S. citizen.

45. Ang pakikinig sa mga paborito kong kanta ay isang nakagagamot na paraan upang maibsan ang aking mga problema.

46.

47. Naghihirap na ang mga tao.

48. Pinigilan nya ang mga kamay ko, Wag!

49. Tumalikod siya bigla saka pumasok sa kwarto niya.

50. Es importante tener en cuenta que el clima y el suelo son factores importantes a considerar en el proceso de cultivo del maíz

Recent Searches

choosepointonlywhyguiltyprovideddeclareechavebeforeimpitstringgeneratedprogramming,currentsolidifybituinandroidcuandoremembercontrolledpackagingmonitorpaceamountmagbibiyahepapuntangculturalnalakihoneymoonmahiyatangekspinangalanangabut-abottagaytayservicesfollowingpumayagmagalitmakausappagpalitsabongpinyapaakyatmataaasindependentlymembersnoonnaglabananwingguardaaccederenchantedmaluwangchamberskilogeneratemichaelremotetalenamumutlaencuestassasamahanmakasalanangartistmagtagopanibagongdumikitprincipalessay,benefitsriegahumigananoodinintayricopusabilisorryencounternanlalamigeverywindowditopalibhasapinakamatapatkongresoipinagbibiliterminonabigkasmbricosanakmakikitulogkasiyahanadditionally,pataypeaceamericabuwansafenakakatakottinigilanconsideredpagka-maktolikinasasabikpagsambananghuhulidininogensindenaguusapalikabukinyourfilipinainilalabasjejutinatanongkumalantoghumihingipinapakinggangalakaffiliateyatatshirtitimcadenaspadonepersonsmaramimababawmatagalkanyasanayprotestaworkdaynakatitigikinalulungkothatenutsnagbasamurang-murainspirasyonfilmmeriendakikitajobspinabayaaneconomynag-angatlabing-siyampinapasayapumapaligidmahahanaysidorevolutioneretpagpanhikphilanthropynagtakamabihisanpaghaharutanmakakibomakawalahouseholdnapakalusogbumibiliginawarannakainompropesorpagmasdanpayapangmisyunerongnabigayadmireddogskinalasingeroginaganoonbangkopollutiondrewfistskingdarkipinalitbroadbetanakakunot-noonggumagalaw-galawpagongtuloygonefiancegulomatiwasayorasanpagkalitotinapaymahusaylargermamayaeskuwela