Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

18 sentences found for "bio-gas-developing"

1. Bias and ethical considerations are also important factors to consider when developing and deploying AI algorithms.

2. Cancer is a complex disease, and ongoing research and collaboration are essential for developing new treatments and improving patient outcomes

3. Electric cars are environmentally friendly as they emit no tailpipe pollutants and produce zero greenhouse gas emissions.

4. Ha? Anong konek ng gas sa taong nagugutom?

5. Hospitalization can increase the risk of developing infections, and patients may be isolated or placed in quarantine if necessary.

6. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

7. Musk has been at the forefront of developing electric cars and sustainable energy solutions.

8. Musk has expressed interest in developing a brain-machine interface to help treat neurological conditions.

9. Quitting smoking can improve one's health and reduce the risk of developing smoking-related illnesses.

10. She was worried about the possibility of developing pneumonia after being exposed to someone with the infection.

11. The elderly are at a higher risk of developing pneumonia.

12. The patient's family history of high blood pressure increased his risk of developing the condition.

13. The patient's family history of leukemia increased their risk of developing the disease.

14. Understanding the biology of viruses is critical to developing effective treatments and vaccines, and to preventing future pandemics.

15. Users can create an account on Instagram and customize their profile with a profile picture, bio, and other details.

16. Users can create and customize their profile on Twitter, including a profile picture and bio.

17. Wag na sabi, wag kang magsayang ng gas maraming nagugutom!

18. While the advanced countries in America and Europe have the wealth and scientific know-how to produce solar and nuclear energy on a commercial scale, the poorer Asiatic countries like India, Pakistan, and Bangladesh may develop an energy source by bio-gas-developing machines

Random Sentences

1. Les hôpitaux sont équipés pour fournir des soins d'urgence aux patients.

2. Les personnes âgées ont souvent des problèmes de santé chroniques qui nécessitent une attention particulière.

3. Bumisita kami sa museo at kinuha ang libreng mapa ng mga eksibit.

4. Gaano ka kadalas nag-eehersisyo?

5. The zoo houses a variety of animals, including lions, elephants, and giraffes.

6. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

7. Sa facebook ay madami akong kaibigan.

8. Nais ko sanang magkita tayong muli dito sa halamanang ito mamayang gabi.

9. Sa takip-silim, mas maganda ang kulay ng langit dahil sa kakaibang mga kulay.

10. Tengo dolor de garganta. (I have a sore throat.)

11. Inakalang magugustuhan ng lahat ang ideya niya, pero tinanggihan ito.

12. Pasensya na pero kailangan ko nang umalis.

13. "Dog is man's best friend."

14. Sueño con tener la libertad financiera para hacer lo que quiero en la vida. (I dream of having financial freedom to do what I want in life.)

15. Jennifer Lawrence won an Academy Award for her role in "Silver Linings Playbook" and is known for her performances in the "Hunger Games" series.

16. Different types of work require different skills, education, and training.

17. Ang mga kawani sa serbisyo-publiko ay dapat na itinuring bilang mga tagapaglingkod ng bayan.

18. Elektronik kan hjælpe med at forbedre adgangen til information og vidensdeling.

19. At være bevidst om vores handlinger og beslutninger kan hjælpe os med at undgå at skade andre og os selv.

20. TikTok has faced controversy over its data privacy policies and potential security risks.

21. Medyo kakaiba ang pusang ito sapagkat makapal ang kulay dalandan na balahibo.

22. Ang pagtambay sa ilalim ng puno ay nagdudulot ng maginhawang lilim mula sa init ng tanghali.

23. James A. Garfield, the twentieth president of the United States, served for only 200 days in 1881 before his assassination.

24. Bis morgen! - See you tomorrow!

25. Masamang droga ay iwasan.

26. Ito lang naman ang mga nakalagay sa listahan:

27. Gawan ninyo ng paraang makalabas po sana ako sa pagkakakulong ko sa loob ng prutas na ito.

28. Ang mga pag-uusig at pang-aapi ay mga halimbawa ng malubhang paglapastangan sa karapatan ng tao.

29. Magkano ang tiket papuntang Calamba?

30. En invierno, la contaminación del aire puede ser un problema debido a la calefacción en interiores y a la menor circulación del aire exterior.

31. Ang poot ay isang emosyon na dapat kong matutunan na kontrolin at harapin nang maayos.

32. Hindi dapat natin pahintulutan ang paglapastangan sa karapatan ng mga mahihina at marhinalisadong sektor ng lipunan.

33. Advanced oscilloscopes offer mathematical functions, waveform analysis, and FFT (Fast Fourier Transform) capabilities.

34. Sa gitna ng gubat, nagbabaga ang apoy na ginagamit nila upang magluto.

35. Uminom siya ng maraming tubig upang iwasan ang bungang-araw.

36. The United States is a global leader in scientific research and development, including in fields such as medicine and space exploration.

37. Cuídate mucho en ese barrio, hay algunas zonas peligrosas.

38. Nagsusulat ako ng mga pangaral at talumpati para sa mga okasyon sa paaralan.

39. Ang kanyang natatanging abilidad sa musika ay nagdala sa kanya sa internasyonal na kasikatan.

40. Stuffed Toys, Mini-Helicopter, Walkie-Talkie, Crush Gear, Remote Controlled Cars, at higit sa lahat, ang Beyblade.

41. Kapag mayroong mga hindi inaasahang pangyayari sa buhay, madalas na nagkakaroon ng agam-agam sa mga tao.

42. El arte abstracto tiene una simplicidad sublime que pocos pueden entender.

43. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

44. Napakalaki pala ng agila sa malapitan!

45. Andre helte er stille helte, der arbejder i skyggerne.

46. Thomas Jefferson, the third president of the United States, served from 1801 to 1809 and was the principal author of the Declaration of Independence.

47. Maagapan natin ang walang humpay na paghaba ng kaniyang buhok, subalit hindi na natin maibabalik ang normal na kapal nito.

48. Masama ho kasi ang pakiramdam ko.

49. Arabica beans are generally considered to be of higher quality and have a milder flavor.

50. Hinagud-hagod niya ang mga kamao.

Recent Searches

bio-gas-developinglinggoprogramming,unitedsentenceininomexpertmapakalilackuriginisingstevenananalomiyerkolesheyaanhinwatchmonsignorpinakabatangmakahiramtungotobacconagpasamanapasubsobmauliniganvirksomhedermagkasamatinakasanleadersnamatayi-rechargemapagkatiwalaanmusicdurantenakarinigamuyinpinangaralanbayadblusangkinamumuhianginugunitaharipagkakatayonapakamisteryosololanagpipiknikhila-agawankaloobangpinakamatabangpinapakiramdamanmagnakawpinagpatuloyika-12masaganangnaglaonhinahanapnapakabilisre-reviewpaparusahantatagalnauliniganmagkakaroonnagpakunotpronounmaliksipondosumisidlumbaynahantadgrocerynagsimulambricosattorneypaalamsugatwonderagostolabahindalawinmukhasongsdalawangsisterinvitationself-defensekalupigagambamonumentomayabongnaantigindiatinioassociationbulakpadabogkontingdeletingmaasahanstartedrequirelutuinbilingservicesmasayafull-timelabingmayoflexibleroomgrewultimatelypanghabambuhaymaidnamungahimigspeechanimcalleyegracebornmalawakpresidentialtotooinsteadtissueaboventamumurapokermasaktankumustaasiaticmungkahiaayusinnagitlainilagaycoachinghardinteragererillegalfarmiintayinbyggetintensidadmagsi-skiingbloggers,pakakatandaanmasasayaconcerncompaniessusunodnagtatakaehehedispositivoshiramtagalkuyanuhsparewelltaongmatatengabasaplatformgayagayundinmakaiponorderinvitaminboseskaninopilipinomaraminakadapahouseholdasogabrielltosaraherramientamaisusuotpinaghatidannakuhangnag-oorasyonmakauuwinakikilalangsalu-saloano-anotaga-nayonprobablementelabanprocesovampiresestablishpakainsinipangbecomeinantok