Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

18 sentences found for "bio-gas-developing"

1. Bias and ethical considerations are also important factors to consider when developing and deploying AI algorithms.

2. Cancer is a complex disease, and ongoing research and collaboration are essential for developing new treatments and improving patient outcomes

3. Electric cars are environmentally friendly as they emit no tailpipe pollutants and produce zero greenhouse gas emissions.

4. Ha? Anong konek ng gas sa taong nagugutom?

5. Hospitalization can increase the risk of developing infections, and patients may be isolated or placed in quarantine if necessary.

6. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

7. Musk has been at the forefront of developing electric cars and sustainable energy solutions.

8. Musk has expressed interest in developing a brain-machine interface to help treat neurological conditions.

9. Quitting smoking can improve one's health and reduce the risk of developing smoking-related illnesses.

10. She was worried about the possibility of developing pneumonia after being exposed to someone with the infection.

11. The elderly are at a higher risk of developing pneumonia.

12. The patient's family history of high blood pressure increased his risk of developing the condition.

13. The patient's family history of leukemia increased their risk of developing the disease.

14. Understanding the biology of viruses is critical to developing effective treatments and vaccines, and to preventing future pandemics.

15. Users can create an account on Instagram and customize their profile with a profile picture, bio, and other details.

16. Users can create and customize their profile on Twitter, including a profile picture and bio.

17. Wag na sabi, wag kang magsayang ng gas maraming nagugutom!

18. While the advanced countries in America and Europe have the wealth and scientific know-how to produce solar and nuclear energy on a commercial scale, the poorer Asiatic countries like India, Pakistan, and Bangladesh may develop an energy source by bio-gas-developing machines

Random Sentences

1. El agricultor cultiva la tierra y produce alimentos para el consumo humano.

2. Sa panahon ng kahirapan, mahalaga ang mga kaulayaw na handang magbigay ng suporta.

3. La música es una forma de arte universal que se ha practicado en todas las culturas desde tiempos ancestrales

4. There are also concerns about the environmental impact of mobile phones, as the devices are often discarded after a short period of use

5. Sueño con tener mi propia casa en un lugar tranquilo. (I dream of having my own house in a peaceful place.)

6. The exam is going well, and so far so good.

7. ¿Cómo has estado?

8. Omelettes can be cooked to different levels of doneness, from slightly runny to fully set.

9. Wag magtaka kung ikaw ay bumagsak sapagkat hindi ka naman nag-aral.

10. The team lost their momentum after a player got injured.

11. Nagpakilala ang binata bilang isang prinsipe ng isang malayo at kaibang kaharian.

12. Nakatanggap umano siya ng isang liham mula sa isang taong matagal nang nawala.

13. Kumain ako ng sinigang sa restawran.

14. Lumiwanag ang langit pagkaraang umalis ang ulan.

15. Amazon has faced criticism over its treatment of workers and its impact on small businesses.

16. In recent years, the telephone has undergone a major transformation with the rise of mobile phones

17. Las serpientes hibernan durante los meses más fríos del año, reduciendo su actividad metabólica y buscando refugio en lugares protegidos.

18. Many people go to Boracay in the summer.

19. Matapos mahuli, nanumpa siya ng katapatan sa Estados Unidos.

20. Natapos ko ang aking thesis sa dakong huli bago ko ito isinumite.

21. Nakatitig siya sa tatlo pa niyang kapatid.

22. Kailangan mo ng matapang na puso upang lumaban sa agaw-buhay na mundo ng negosyo.

23. They may draft and introduce bills or resolutions to address specific concerns or promote change.

24. Nagtataka ako kung bakit hindi mo pa sinasabi sa akin ang totoo.

25. Cut to the chase

26. Ulysses S. Grant, the eighteenth president of the United States, served from 1869 to 1877 and was a leading general in the Union army during the Civil War.

27. Ang pagpapahalaga sa mga kabuluhan ng buhay ay mas mahalaga kaysa sa mga kababawan ng mundo.

28. Binati niya ito ng "Magandang umaga sa iyo".

29. Gumawa ng pangit na drowing ang kaibigan ko.

30. Bitawan mo nga ako, kakainin ko 'to.

31. Ang mga taong naghihinagpis ay nagtipon upang magbigay suporta sa isa't isa.

32. Matagal nang hindi niya nabanggit ang pangalan ng kaibigan niya, kaya parang naglimot na siya rito.

33. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

34. Tinutulan ng komunidad ang anumang uri ng abuso laban sa mga kababaihan.

35. Sa takip-silim, nakikita mo ang kagandahan ng mga kalsada dahil sa mga ilaw na nagbibigay ng magandang siluet sa mga tao.

36. Foreclosed properties can be a good option for those who are looking for a fixer-upper project.

37. Sa larong volleyball, ipinasa ni Liza ang bola sa kanyang kakampi.

38. Magkita na lang po tayo bukas.

39. Ginagamit ang salitang "waring" upang ipahiwatig ang isang hinuha o tila isang bagay na maaaring totoo, ngunit hindi pa tiyak.

40. Kahit na lilipad ang isip ko'y torete sa'yo.

41. I envy those who are able to tune out the news and live in their own little bubble - ignorance is bliss, I suppose.

42. Ang mga bayani ay nagturo sa mga kabataan ng mga aral at kahalagahan ng pagsisilbi sa bayan.

43. Mahusay na mahusay kumita ng pera si Kablan.

44. Ailments can have physical symptoms, such as pain, fatigue, or fever, as well as psychological symptoms, such as anxiety or depression.

45. Kumain ka na ba? Tara samahan kitang kumain.

46. Hindi pinakinggan ng Ada ang abuhing Buto ng Kasoy.

47. Ang manlalakbay ay naglakbay upang lumibot sa iba't ibang bansa at masaksihan ang iba't ibang kultura.

48. Oy saan ka pupunta?! sigaw nya.

49. Ang galing nya maglaro ng mobile legends.

50. I received a lot of happy birthday messages on social media, which made me feel loved.

Recent Searches

bio-gas-developingshutpahiraminalalayancornerphilosophicalmakabawitinutopmusmospokerpatipinanalunannaapektuhanrocktagpiangmagmulamarahanbibigyanformslaylaymedidaandamingmaskarapagkapasansistemasunannapakagandamulingkumaenlalakengmanysweetlikodsanaykawalmaasimnegosyantemag-orderhuliminamahalmagbantaynetonasawigayunpamannagdabogsinedisappointnasanbaku-bakongfriendscovidperohitamobilemakakabaliknilapitanmakatulogtsssmakatulonghdtvsatisfactionkakaibaaralbutchnatawakawayandibdibnaglahongexperience,hiramnangangaraloutlinesganitopagkagracedrowingligaworlde-booksbilerthankspasasaanfamilysynligesakayhadngunitproductskalyestyrermagpahingauulaminpumitasmaatimpepeellenpasangpalibhasapagkabatamediantebuhaylikelyheresoonyoninabutanpare-parehohitikayantatanggapinresignationselaeditorpansinsenadorpublicitynamanallmadalingcoraanak-pawismatataginyobiocombustiblesimportantesnamulatafterngusonamumukod-tangipangarapresearch,magpapaligoyligoyfraonlyalsointerests,sulingansparkthanklahatkinasisindakanayokonatatakotdurastatawaganrestawanblesstanganautomatiskjuniopinagwagihangtsuperfreelancercommunicationsdahilmagpapapagodmatangkadsumasakitconsueloampliachildrenalineeeehhhhbulsaharingdoble-karamadalitakesmakipag-barkadanormal1970smagnifytakboisinaboykarangalanmangyaricoughingnagsabaymagtakatumulakumutanggulathumahagokiglapnagdiriwangbumalinglumapitmaibigaykalabawmanagerlugarmahirapuncheckeditsdumukotmightbatangimpornownanlilisik