Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

18 sentences found for "bio-gas-developing"

1. Bias and ethical considerations are also important factors to consider when developing and deploying AI algorithms.

2. Cancer is a complex disease, and ongoing research and collaboration are essential for developing new treatments and improving patient outcomes

3. Electric cars are environmentally friendly as they emit no tailpipe pollutants and produce zero greenhouse gas emissions.

4. Ha? Anong konek ng gas sa taong nagugutom?

5. Hospitalization can increase the risk of developing infections, and patients may be isolated or placed in quarantine if necessary.

6. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

7. Musk has been at the forefront of developing electric cars and sustainable energy solutions.

8. Musk has expressed interest in developing a brain-machine interface to help treat neurological conditions.

9. Quitting smoking can improve one's health and reduce the risk of developing smoking-related illnesses.

10. She was worried about the possibility of developing pneumonia after being exposed to someone with the infection.

11. The elderly are at a higher risk of developing pneumonia.

12. The patient's family history of high blood pressure increased his risk of developing the condition.

13. The patient's family history of leukemia increased their risk of developing the disease.

14. Understanding the biology of viruses is critical to developing effective treatments and vaccines, and to preventing future pandemics.

15. Users can create an account on Instagram and customize their profile with a profile picture, bio, and other details.

16. Users can create and customize their profile on Twitter, including a profile picture and bio.

17. Wag na sabi, wag kang magsayang ng gas maraming nagugutom!

18. While the advanced countries in America and Europe have the wealth and scientific know-how to produce solar and nuclear energy on a commercial scale, the poorer Asiatic countries like India, Pakistan, and Bangladesh may develop an energy source by bio-gas-developing machines

Random Sentences

1. Nakasuot ng pulang blusa at itim na palda.

2. Ang mga miyembro ng komunidad ay hinikayat na magbigay ng kanilang mga mungkahi upang mapabuti ang mga serbisyo ng pamahalaan.

3. The Lakers' success can be attributed to their strong team culture, skilled players, and effective coaching.

4. The Pyramids of Chichen Itza in Mexico are an impressive wonder of Mayan civilization.

5. Tila bakal na kumakapit ang mga kamay.

6. Bakit ho, saan ninyo ko dadalhin?

7. La acuarela es una técnica de pintura que utiliza pigmentos mezclados con agua.

8. Masayang-masaya ako ngayon dahil nakapasa ako sa board exam.

9. I know you're going through a tough time, but just hang in there - you're not alone.

10. Ang mahiwagang pagsagot ng prinsipeng tila ba mag agam-agam.

11. Sa paggamit ng mga kagamitan, huwag magpabaya sa tamang pag-aalaga at pagpapanatili nito.

12. Ulysses S. Grant, the eighteenth president of the United States, served from 1869 to 1877 and was a leading general in the Union army during the Civil War.

13. En algunas culturas, se celebran festivales de invierno como el Hanukkah y el solsticio de invierno.

14. Technology has also had a significant impact on the way we work

15. Tahimik ang buong bahay, waring walang tao sa loob.

16. Kailangan mong higupin ang gamot gamit ang straw.

17. Mahilig siyang mag-ehersisyo at kumain ng masustansya, samakatuwid, malakas ang kanyang pangangatawan.

18. Higit kong daramdamin kung ako na itong nagawan ng di mabuti ay sa kanya pa manggagaling ang huling salita.

19. Have they fixed the issue with the software?

20. She's always creating drama over nothing - it's just a storm in a teacup.

21. Lumabas na ako ng cr. Nakatayo lang ako dun.

22. Libre ba si Renato sa Huwebes ng gabi?

23. Ilan ang telepono sa bahay ninyo?

24. Eksport af teknologi er en stigende del af den danske eksport.

25. Es importante evitar rascarse o manipular las heridas para facilitar su cicatrización.

26. Nicole Kidman is an Academy Award-winning actress known for her performances in movies such as "Moulin Rouge!" and "The Hours."

27. Naglalaro ang walong bata sa kalye.

28. Additionally, the use of mobile phones has raised concerns about privacy, as the devices can be used to track individuals' locations and gather personal information

29. Ano ang nangyari sa Compostela Valley?

30. Bago magsimula ang kasal, nagdaos sila ng tradisyunal na ritwal upang basbasan ang mag-asawa.

31. Money can be used for charitable giving and philanthropy, which can have positive impacts on communities and society as a whole.

32. Ang pangalan niya ay Mang Sanas.

33. Hindi dapat natin kalimutan ang ating mga responsibilidad, datapapwat ay may mga pagkakataon na napapabayaan natin ito.

34. "Mahalaga ang kalusugan, kaya alagaan natin ang ating katawan," ani ng doktor.

35. Mahalaga ang maagap na pagtugon sa pangamba upang maiwasan ang mas malaking panganib.

36. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

37. "Ang hindi marunong magmahal sa sariling wika, daig pa ang hayop at malansang isda" ay isang bukambibig na nagpapahayag ng halaga ng pagmamahal at pagpapahalaga sa ating wika at kultura.

38. B-bakit mo pinatay yung ilaw?! biglang tanong ni Cross.

39. Les visites sont souvent autorisées à l'hôpital pour soutenir les patients pendant leur convalescence.

40. Ada beberapa tradisi dan kepercayaan terkait kelahiran di Indonesia, seperti menjaga diri dan pola makan selama masa kehamilan.

41. El control de las porciones es importante para mantener una dieta saludable.

42. Superman possesses incredible strength and the ability to fly.

43. Nagbasa ako ng libro sa library.

44. Na-suway ang driver ng tricycle nang lumabag ito sa batas trapiko.

45. Elektronisk udstyr kan hjælpe med at optimere produktionsprocesser og reducere omkostninger.

46. Maganda ang kulay ng mga puno sa panahon

47. They have been renovating their house for months.

48. El invierno es una época del año en la que las personas pasan más tiempo en interiores debido al clima frío.

49. Ang pagbabayad ng utang sa tamang panahon ay nagpapakita ng katapatan sa pagbabayad ng mga utang at magiging magandang rekord sa credit score.

50. Sa pagbisita niya sa museo, pinagmamasdan niya ang mga antique na kagamitan.

Recent Searches

bio-gas-developingwebsitemangingibiglegitimate,pdapaglisanbecamecashtungkolingatankalabandyanpampagandapumasokreguleringtigilemocionalnagpapakinismagagawasedentaryyayaprobinsiyaoktubreifugaogayunmanaplicacionesdoonnakapagreklamomabibingikagipitanpanggatongtodayyakapplatformsmamanhikanmaligayabuwayabutasbinatakcomplicatedyearspinsanritoumakyatmakakatulonginaapitwo-partysupilinnaglaonsiyamlikelythereforeabigaelano-anopag-aralinnuevolalapitsiguroregulering,klaseiilanpoongmagtigilmaghahabilarongbeforebagamaabut-abotpagpasensyahanparkingmadulasakorewardingsumasambaboxtanganbawaldiyandiligincardigansalatumikimhatepagsubokfitkuwentosimulaguerreromabutibalahibokasalukuyanstocksekonomiyakamag-anaktargetbumilihimigkatutuboanaknahigapangalansahodactingnanlalamigbillmalapitmaghilamosdatinilulonpatiandysummerfreekumaenkahilingandilimknowdiyaryoprogramming,estudyantefuncionarisinamakuwartobatangprosesomagbaliktutoringvelfungerendevegasnerosboyfriendedsamahagwaymoderndiyostibigbangkonglabasnazarenopaglingonmarioniyanenglandmartialmarchantpumitassobracandidatekaraniwangrambutanlumungkothalu-halonagsusulatnakaririmarimjobsso-calledcorrectingkongresotinike-booksupangsinuotmind:pakibigaymalassteercommercebighanifriendsbalatmaliksimalungkotdulagracescienceakmangsinoabutanpeacelumbaymangingisdangnoongdiretsonakahaindakilangpeepiniangatmalapadsumigawkambingmbricostwinklehiningife-facebookisamaevolvewaringkapatawaranmagbibitak-bitakaeroplanes-all