Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "kataga"

1. Nabigkas ni Tarcila ang mahiwagang kataga bago nalagutan ng hininga sina Lala, Dada at Sasa kaya sa isang kisapmata ang tatlong dalaga ay naging ISDA!

Random Sentences

1. Ang kanyang mga galaw ay tila naglalayo ng loob ng iba, palayo sa kanya.

2. Panahon na lang ang hahatol kung nararapat na ngang ibalik sa dating anyo si Kiko.

3. Naglalakad kami sa baybayin ng dagat sa hatinggabi at nasisilayan namin ang magandang tanawin ng buwan.

4. Sa pag-aaral ng mga palaisipan, mahalagang maging mapanuri at malikhain upang malutas ang suliranin.

5. Napansin ni Rabona na kumakapal ang buhok nito sa katawan.

6. Tara na. binuksan ko yung pinyuan tapos lumabas kami.

7. Bumisita kami sa museo at kinuha ang libreng mapa ng mga eksibit.

8. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

9. The discovery of cheating can lead to a range of emotions, including anger, sadness, and betrayal.

10. Leukemia can affect people of all ages, although it is more common in children and older adults.

11. En la realidad, hay muchas perspectivas diferentes de un mismo tema.

12. Lumampas ka sa dalawang stoplight.

13. La habilidad de Leonardo da Vinci para crear una ilusión de profundidad en sus pinturas fue una de sus mayores aportaciones al arte.

14. He blew out the candles on his birthday cake and made a wish.

15. He cooks dinner for his family.

16. Kucing di Indonesia sering dijadikan sebagai hewan peliharaan yang cocok untuk apartemen atau rumah kecil.

17. The movie was absolutely captivating from beginning to end.

18. The level of sweetness can vary in different types of sugar and sweeteners.

19. Nilinis ng mga taga-Tungaw ang kanilang maruming ilog.

20. Gracias por creer en mí incluso cuando dudaba de mí mismo/a.

21. Quitting smoking can improve one's health and reduce the risk of developing smoking-related illnesses.

22. Wedding favors are small gifts given to guests as a thank you for attending the wedding.

23. Bumili si Andoy ng sampaguita.

24. Nangangamba ako sa pagdidilim ng aking paningin dahil sa pagkakaroon ko ng mataas na grado.

25. May problema ba? tanong niya.

26. Facebook has billions of active users worldwide, making it one of the largest social media platforms.

27. The internet is full of fashion blogs. They're a dime a dozen.

28. Smoking is a harmful habit that involves inhaling tobacco smoke into the lungs.

29. Ang mahal pala ng iPhone, sobra!

30. El agua tiene propiedades únicas, como la capacidad de disolver sustancias y regular la temperatura.

31. Nag mungkahi naman ang Mayor na dapat unahin munang bigyan ng ayuda ang mga senior citizens.

32. The concept of money has been around for thousands of years and has evolved over time.

33. Di na natuto.

34. Takot siyang salatin ang sahig dahil sa maaaring may ipis.

35. Tinuruan ng albularyo ang kanyang anak upang maipasa ang tradisyon ng pagpapagaling gamit ang mga halamang gamot.

36. Vi kan alle være helte i vores eget liv og gøre en forskel for andre.

37. The Ugly Duckling is a story about a little bird who doesn't fit in until he discovers he's actually a beautiful swan.

38. The French omelette is a classic version known for its smooth and silky texture.

39. Naupo siya sa sofa at inilagay yung bitbit niya sa mesa.

40. Alice falls down a rabbit hole and enters a whimsical world in Alice in Wonderland.

41. No hay nada más poderoso que un sueño respaldado por la esperanza y la acción. (There is nothing more powerful than a dream backed by hope and action.)

42. In recent years, the telephone has undergone a major transformation with the rise of mobile phones

43. James K. Polk, the eleventh president of the United States, served from 1845 to 1849 and oversaw the Mexican-American War, which resulted in the acquisition of significant territory for the United States.

44. Después de varias semanas de trabajo, finalmente pudimos cosechar todo el maíz del campo.

45. I have been jogging every day for a week.

46. The pneumonia vaccine is recommended for those over the age of 65.

47. ¿Qué edad tienes?

48. Instagram has become a platform for influencers and content creators to share their work and build a following.

49. Nakasuot siya ng itim na pantalon.

50. Si Carlos Yulo ang naging inspirasyon sa pagbuhay muli ng gymnastics program sa Pilipinas.

Similar Words

katagalkatagalanNapakatagalkatagang

Recent Searches

katagatamaareassumapitbutchtrajematulunginginanglalamunankulanggodtyatacarolself-publishing,struggleddeterioratekingdomnooomgbukodipaliwanagarbejderpetsangisinalangtransmitshmmmmcontestbroadcastmodernsipagsukatbabesusalawssinunodibigclientshealthbatokbatiatentopinalutotoosumamadragonestablishenchantedmulighedmatabamallsumabogbelievedfonomasknakalipassamfundprovide1982yesrelievedactionburdenworkshoppakpakevolvedconditioningkalanclocksofawhetherseenpumasokheftyledfalladulaandretipidelectedfeedbackcontinuednakangangangtulalatsinelasnakalockkahusayanayostsuperejecutanmagnifynakahainpinagkasundopublicationpaldabagkuscubiclesumisilipnaglabanansagapkasaysayanmejonapatingalaalamidsigemakahingimartessuccessuusapanmanalobutihingtoreteabrilbio-gas-developingmahahabagivesilbingcontent,baird1000becomingnagsidalorailwaysyepsiempretryghedthanksorebarneskulturshowsumuuwibumababakababayanlumamanglalawiganapollosumisidbalinganpinggankapamilyaboracayhanapinbasketballpaglayasemocionalpaakyatkumainsakinlugawobservation,maghapongvegastaximaligayabiyernesctricastmicao-ordermontreallumbaytotoopondokunwaupuandiyosamaayoskagabihoteldesarrollarsakainantaytsakaindiasapotubogranadamansanascomputere,suotkumantatreswaterargueailmentslaki-lakiiatfparopinakamaartengmahiwaganakakatawaeventspinakamahalagangginugunitanakabulagtangnakatunghaynakaluhodpinagtagponagpapasasamagpapigilmaglalakad