Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "hit"

1. A series of earthquakes hit the region, causing widespread damage.

2. Her music career took off with her debut album Yours Truly in 2013, featuring the hit single "The Way."

3. His first hit, That's All Right, was released in 1954 and quickly climbed the charts

4. Hit the hay.

5. The cake was a hit at the party, and everyone asked for the recipe.

6. The company's profits took a hefty hit after the economic downturn.

7. The culprit behind the hit-and-run accident was later caught and charged with vehicular manslaughter.

8. The momentum of the train caused it to derail when it hit a curve too quickly.

9. This was followed by a string of hit songs, including Blue Suede Shoes, Hound Dog and Heartbreak Hotel

Random Sentences

1. Bumisita kami sa museo at kinuha ang libreng mapa ng mga eksibit.

2. Mabuti pa nga Babe, bugbugin mo na yan. pagbibiro nila.

3. Muntikan na akong mauntog sa pinto.

4. Sambal adalah saus pedas yang terbuat dari cabai dan bumbu-bumbu lainnya.

5. She has won a prestigious award.

6. Muchos agricultores se han visto afectados por los cambios en el clima y el medio ambiente.

7. Después de desayunar, salgo a correr en el parque.

8. Thomas Jefferson, the third president of the United States, served from 1801 to 1809 and was the principal author of the Declaration of Independence.

9. ¿Dónde está el baño?

10. Political campaigns use television to reach a wide audience, and political debates and speeches are often televised

11. The police were searching for the culprit behind the rash of robberies in the area.

12. All these years, I have been building a life that I am proud of.

13. Napaiyak si Aling Pising ng makita ang mga tuyong kahoy at posporo sa ilalim ng kanilang bahay.

14. Sila ang unang angkan ng mga aso sa daigdig.

15. Ang pagpapakilala ng bagong lugar o setting ang nagbigay ng bagong perspektibo sa kuwento sa kabanata.

16. Television has also had a profound impact on advertising

17. Napakagaling nyang mag drawing.

18. La esperanza y los sueños son una parte importante de la vida. (Hope and dreams are an important part of life.)

19. Dedication to environmental conservation involves taking actions to protect and preserve our planet for future generations.

20. Nandito ang mga kaklase ni Raymond.

21. Nous avons invité tous nos amis et notre famille à notre mariage.

22. Si Rizal ay kilala rin sa kanyang pagmamahal sa kanyang bansa at sa kanyang mga kababayan.

23. Ang pagbasa ng mga positibong pananaw at inspirasyonal na mga salita ay nagdudulot sa akin ng isang matiwasay na pananaw sa buhay.

24. It's important to read food labels to understand ingredients and nutritional information.

25. AI algorithms can be used to create personalized experiences for users, such as personalized recommendations on e-commerce websites.

26. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

27. Quitting smoking can improve one's health and reduce the risk of developing smoking-related illnesses.

28. Malilimutin si Lolo kaya’t lagi niyang hinahanap ang kanyang salamin.

29. Maya-maya lang, nagreply agad siya.

30. Saan ako nag-aaral ng kindergarten?

31. Pagtitinda ng bulakalak ang kanilang ikinabubuhay.

32. Claro que te apoyo en tu decisión, confío en ti.

33. Ang pinakamalapit na lugar na kanilang narating ay mababa pa rin ang altitude.

34. Madali naman siyang natuto.

35. Kailangan mong malaman kung sino ang mga taong bukas palad sa iyo upang hindi ka masaktan.

36. The patient's quality of life was affected by the physical and emotional toll of leukemia and its treatment.

37. Después del nacimiento, el bebé será evaluado para asegurarse de que está sano y para determinar su peso y tamaño.

38. Ang daming palamuti ang nakalagay sa kanyang cake.

39. Si Mang Ernan naman na isang manunulat, isa ring propesor sa isang unibersidad sa maynilaat nagging kasapirin sa iba't ibang samahan

40. She helps her mother in the kitchen.

41. Ang paggamit ng droga ay madaling simulan, ngunit mahirap nang itigil.

42. Ahh... haha. Umiling na lang ako bilang sagot.

43. He was a master of several different styles, including Wing Chun, boxing, and fencing, and he developed his own style, Jeet Kune Do, which emphasized fluidity and adaptability

44. Ano ang ikinamatay ng asawa niya?

45. A penny saved is a penny earned

46. Jeg kan ikke stoppe med at tænke på ham. Jeg er virkelig forelsket. (I can't stop thinking about him. I'm really in love.)

47. Ang pagkakaroon ng magandang asal at ugali ay mahalaga sa bawat relasyon, samakatuwid.

48. The telephone has also played an important role in politics, as it has made it possible for leaders to communicate quickly and easily

49. The website's social media buttons make it easy for users to share content on their social networks.

50. Musk was born in South Africa and later became a citizen of the United States and Canada.

Similar Words

KahitpagguhitgumuhithitaguhithitsurahitikiguhitahitDalanghitaipihit

Recent Searches

hitlolotangekspaparusahanmagtanimeksportentrentaipaliwanagsapilitangjulietbilihinnagtutulungansayunconstitutionalpagsayadnapansinomgjerrypagsidlanreguleringmagsasakaginugunitanuclearaalisnanonoodnatanongalayevolucionadocigarettesinongmakingmaputinahihilosharingkumalantognapasubsobconnectmagbayaddipanginformednariningcompletamenteentryjohnnunosamakatwidunoshoydedicationmakukulayexpectationsgagamitsuotpagtangisdidnightmadadalamasamangvideoslasaisipsakimpulispapertoybumalingdilawmesalumulusobexamplesynckapilingmasterlearningmetodiskinsteadsamemestbilibmananaigeuphoricutak-biyatanodperfectnakisakayredformasantoklumayonapahintoenchantedreservedpaladfourbakemahalgirlyarinakakaenpaghamakmakahingibinatilyocinecondoreadersventadingginbadingshareiniwankinagagalakngitikaninumantinanonginiisipanubayannagdiriwangbuenapabulongafternooncrushprinsipetuluyanmaaringrewardingkarwahengnagwagikisapmatalalakengmabatongadditionibinaonkumilosmagta-trabahounonagsiklabmerlindaenglishnagyayangtiemposenduringlivesinfluencesstandbeyondconclusion,2001pagkaimpaktokanyaitinuturingmakakakaenbulakaraokemakapalpogimapakalimagbabalatagalpagkabatatawamaligayaarbejdsstyrkehapag-kainanbyggetnapilingcandidatenag-alalalisteningnagpapaniwalanailigtasbitawanendviderenamingasolinaplanning,neafreedisyembredi-kawasanaroonpeacepepemangingibigpangildisenyotagaroonromanticismoforskel,laborponglibertyriegapunongkahoyenergy-coalnakadapaduwendenakuhangnaiwangroofstockgayundin