Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "aggression"

1. He also believed that martial arts should be used for self-defense and not for violence or aggression

Random Sentences

1. Kung hei fat choi!

2. Magsuot ka palagi ng facemask pag lalabas.

3. Ito lang naman ang mga nakalagay sa listahan:

4. Saan siya kumakain ng tanghalian?

5. The United States has a Bill of Rights, which is the first ten amendments to the Constitution and outlines individual rights and freedoms

6. Holy Week culminates in the celebration of Easter Sunday, when Christians gather to commemorate the resurrection of Jesus and the triumph of life over death.

7. If you think I'm the one who stole your phone, you're barking up the wrong tree.

8. Ngayon ko pa lamang nakita ang halaman na ganito.

9. Ano ang gustong sukatin ni Merlinda?

10. In conclusion, Elvis Presley was a legendary musician, singer and actor who rose to fame in the 1950s and continues to influence the music industry and American culture till this day

11. Omelettes are a popular choice for those following a low-carb or high-protein diet.

12.

13. The relationship between work and mental health is complex and can vary from person to person.

14. Leonardo da Vinci trabajó para los Médici en Florencia.

15. Anong kulay ang gusto ni Elena?

16. The lightweight construction of the bicycle made it ideal for racing.

17. Nagbago nang lahat sa'yo oh.

18. Tinigilan naman ni Ogor ang panunukso.

19. Napakabuti nyang kaibigan.

20. Supergirl, like Superman, has the ability to fly and possesses superhuman strength.

21. They do not forget to turn off the lights.

22. Ailments can impact different populations disproportionately, such as people of color, women, and those with low socioeconomic status.

23.

24. Madalas na nagiging dahilan ng utang ang kawalan ng sapat na pera upang matugunan ang mga pangangailangan.

25. They are not considered living organisms because they require a host cell to reproduce.

26. Her decision to sponsor a child’s education was seen as a charitable act.

27. Napalayo ang talsik ng bola nang ito’y sipain ni Carlo.

28. Kailangan ko ng Internet connection.

29. El tamaño y el peso del powerbank pueden variar según la capacidad de la batería.

30. Sadyang kaunti lamang ang alam kong mga lenggwahe.

31. Amazon started as an online bookstore, but it has since expanded into other areas.

32. Dahil sa pagkabigla at pagkatakot, nagpasya ang matanda na tumakbo na lamang pauwi pero pinigilan siya ng diwata.

33. Anong oras ho ang dating ng jeep?

34. Dahil sa pagkabigla ay hindi na nakapagsalita ang binata at ito ay napaluha na lang.

35. Kumain ako ng sinigang sa restawran.

36. May kanya-kanyang bayani ang bawat panahon.

37. The French omelette is a classic version known for its smooth and silky texture.

38. My sister gave me a thoughtful birthday card.

39. Ang aming pamilya ay mahilig magsagwan sa karagatan tuwing Sabado.

40. Okay.. sige.. intyain ko na lang tawag niya.. thanks..

41. Para sa malilimutin, malaking tulong ang paggamit ng alarm sa cellphone.

42. Humiwalay siya saglit, I'm so sorry. aniya.

43. Ultimately, a wife is a partner and equal in a marital relationship, contributing to the success and happiness of both spouses.

44. Ang hirap naman ng exam nakaka bobo.

45.

46. Ang tubig-ulan ay maaaring magdulot ng malinis na hangin sa pamamagitan ng pag-alis ng polusyon sa hangin.

47. They are not singing a song.

48. L'intelligence artificielle peut être utilisée pour identifier les anomalies dans les données pour prévenir les problèmes futurs.

49. Magsasalita na sana ako ng sumingit si Maico.

50. God is often seen as the creator of the universe, with the power to influence and control natural phenomena and human destiny.

Recent Searches

11pmaggressionulingpangarapprocesserrors,pagpasensyahanincitamenterdinalafuncioneslasingsobralibagfiguresnangmasnakatuwaangobra-maestranaiwangpagongapoyelopinatutunayancelularesbinibiyayaanailmentsmagdamagpapagupitkabighajuanitonapakamotmultosparematamanparkehallriseagospangakosumayamaskaratumatawagstayna-suwaysongsnakatirangipinambiliinjurytamadbio-gas-developingunconventionaltilianimonangyaridadalawinaanhinhinamakcorporationhunyokomunidadisusuothearkatotohananbiyaspaketenakalilipasgulangnaglulusaktinawagdireksyonsiempreebidensyacoatchamberskalabawreviewnanditomaglalakadniyogtamakutodmaarichickenpoxtahimikscalekuligligguropatrickmaramotnagsasabingnag-oorasyoninastapangambakinasisindakanyoutube,ikatlonggulatyespaghamakipagpalitbuung-buoaccederpooktalagamagandangpagtutolpananimloriisulatoutfistssanggolimpactedelvispaabathalaaabotginoongplagastakesmapadalisumusunocompartendadalokahoynagpapakaintignannatutulogabalamakawalafuncionartusongtutorialsadmiredsimplengbehaviorcontinuedcassandratutungojoeisipminutodiscoverednawalamaihaharapmarmaingharitsinapagkaawatalinotelaroquehangaringvalleydiintopicimportantesexigentelubostinuturoflaviomismosementongmaynilacarekawili-wilipakakasalanmarketingyoungiyogoodeveningpigilannakahiganginaaminnakakabangonbooksabsartetiyaaktibistainasikasojeepneymissionpakikipagbabaginlovemaibabuenagovernmentnapakahangailoilobihirangcommercialpirataunangnapatulalaambagtrentafacilitatinglalabassumasaliw