Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "magdaan"

1. Sa harapan niya piniling magdaan.

Random Sentences

1. Hanggang ngayon, si Hidilyn Diaz ay patuloy na nagsasanay at sumusuporta sa mga atletang nangangarap tulad niya.

2. Kucing juga dianggap sebagai hewan yang bisa membantu mengurangi stres dan kecemasan.

3. Parang kaming nageespadahan dito gamit ang walis at dustpan.

4. The character in the movie was content in his simple life, believing that ignorance is bliss.

5. They are building a sandcastle on the beach.

6. Tuwing Chinese New Year, nagtutungo ang mga tao sa mga templo upang magbigay-pugay.

7. May dalawang puno sa harap ng bahay namin.

8. Dahil sa pagtaas ng populasyon sa bansa, yumabong ang pagtatayo ng mga condominiums at mga townhouses.

9. Nakakatakot ang kanilang lugar sapagkat andaming adik.

10. Magsusunuran nang manukso ang iba pang agwador.

11. Hun har en figur, der er svær at ignorere. (She has a figure that's hard to ignore.)

12. During the holidays, the family focused on charitable acts, like giving gifts to orphanages.

13. Pull yourself together and stop making excuses for your behavior.

14. Børn skal beskyttes mod vold, misbrug og andre former for overgreb.

15. Penting untuk memiliki pola pikir yang fleksibel dan terbuka dalam menghadapi tantangan hidup.

16. The United States has a system of representative democracy, where citizens elect representatives to make decisions on their behalf

17. Sa karagatan ay masusumpungan ang magagandang koral at mga isda.

18. May ngiti ng kasiyahang naglalaro sa maninipis na labi ni Aling Marta nang ipihit niya ang kanyang mga paa patungong pamilihan.

19. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

20. Microscopes are commonly used in scientific research, medicine, and education.

21. Tom Cruise is a highly successful actor known for his roles in movies like "Top Gun" and the "Mission: Impossible" series.

22. Hindi ko kayang hindi sabihin sa iyo, sana pwede ba kitang mahalin?

23. Maaari mo ng bitawan ang girlfriend ko, alam mo yun?

24. Les travailleurs indépendants travaillent souvent à leur propre compte.

25. Les travailleurs peuvent être affectés à différents horaires de travail, comme le travail de nuit.

26. Sana hinde na lang ako nagloko. Sana naniwala na lang ako.

27. Omelettes are a popular choice for those following a low-carb or high-protein diet.

28. Di ko sya maistorbo dahil sya ay nag-aaral pa.

29. Es importante estar atento a las plagas y enfermedades, y utilizar métodos orgánicos para controlarlas

30. He has bought a new car.

31. The elephant in the room is that the project is behind schedule, and we need to find a way to catch up.

32. Pinagpatuloy ko na ang pagkain ko.

33. Ang aso ni Lito ay mataba.

34. Algunas personas coleccionan obras de arte como una inversión o por amor al arte.

35. May nakita umano ang mga residente na kakaibang liwanag sa kalangitan.

36. Ipinaluto ko sa nanay ko ang pansit.

37. Las escuelas privadas requieren matrícula y ofrecen diferentes programas educativos.

38. Ang tunay na kayamanan ay ang pamilya.

39. Di mo ba nakikita.

40. Sino ang nakasuot ng asul na polo?

41. Tumingin ako sa bedside clock.

42. Kanino mo pinaluto ang adobo?

43. Walang konsyerto sa plasa mamayang gabi.

44. Nagpuntahan ang mga tao roon at hinukay ang ugat ng puno.

45. Many churches hold special services and processions during Holy Week, such as the Stations of the Cross and the Tenebrae service.

46. Ang kanyang galit ay nagbabaga sa ilalim ng malamig niyang mga ngiti.

47. Instagram has become a platform for influencers and content creators to share their work and build a following.

48. Many schools and universities now use television as a way to provide distance learning

49. The patient was referred to a specialist in leukemia treatment for further evaluation and care.

50. Sa pagbabasa ng magandang libro, napapasaya at natutulog ako nang matiwasay sa gabi.

Recent Searches

infusionesbirdsmagdaantatlongmukhaumibignapadaanhumigapatongasahanbihasanilayuankataganghelenalumbaymartianbinabafarmaffiliatenamamaistorbolagunatamatambayanmatuliskuwebamatesahotelwikanatulakperwisyosantosathenaganitographicgrammaragadtoretenagbasaitinagoeuphoricargueumaagosattractivepalaysignlandecoalmalisannicoiconsmayakaptumalonmasayajanesobrabokpasyasusunduintoothbrushmayosumasambalatestpropensosubalitbecomeumingitmerry11pmfuradversefeeling4thlayout,morekasinggandastatusmabutingwalletnuclearlinetriplaylaydedication,espadateachmalabosolidifycomputerusingevolvedsambitwindowdraft,boxeachipapahingasafemobileoffentligelcdhowevernaroonpersonspalitanconvertidasbawatalituntuninumalisumanofatherbalitapapayahatinggabigumisingnagngangalangmanananggalpag-ibigkilalang-kilalayamanwaringfilipinomagandangsinimulanbintanaikinatatakotmotiontusindvisalbularyotilaalisvankannalalaroanalyselunespinilitparangkapitbahaykagyatluhaprobinsyabinatanaghihinagpisnamatayindustriyasirhanumikotpagdudugopinakamalapitgalawnag-iisapag-uugalilindolnakikitangradiopamumunogayundinelectyumuyukodisyempretomarmatangpumuntanuonagaparaaalisinantoksukatpostcardimportantespagkalungkotsponsorships,gumagalaw-galawpakanta-kantangnagpapaniwalapinagtagponakaluhodnangampanyagayunmannagre-reviewmakikipaglaromagpa-ospitalnagtatakboklasemalakipocaunahinpagdukwangyunsimbahanjobsnagpatuloynagpabayadmagasawangmagpalibreikinalulungkottraveler