Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "automatisk"

1. Det har også ændret måden, vi planlægger og styrer vores transport, såsom selvkørende biler og flyvemaskiner med automatisk navigation

Random Sentences

1.

2. Mahalagang igalang ang kalayaan ng ibang tao sa pagpapasiya ng kanilang mga sariling buhay.

3. Ang tag-ulan ay nagdadala ng mga pagsubok sa mga nag-aaral dahil sa pagkansela ng klase dahil sa malakas na ulan.

4. For eksempel kan vi nu få adgang til tusindvis af film og tv-shows på vores telefoner og computere, og vi kan styre vores hjem med en app på vores telefon

5. The website's social media buttons make it easy for users to share content on their social networks.

6. Me duele el estómago. (My stomach hurts.)

7. LeBron James continues to inspire and influence future generations of athletes with his remarkable skills, leadership, and commitment to making a difference both on and off the court.

8. Beauty? tanong pa ni Mrs. Lacsamana.

9. Si Ana ay humanga sa disenyo ng saranggola ng kanyang kuya.

10. Gigising ako mamayang tanghali.

11. Bukod pa sa rito ay nagbigay pa ito ng bitamina sa katawan ng tao.

12.

13. Marahil ay hindi pa sapat ang oras na nakalaan para matapos ang proyekto.

14. Puwede bang pahiram ng asukal? Magluluto ako ng cake mamaya.

15. Ang dami nang views nito sa youtube.

16. Es importante tener amigos que nos apoyen y nos escuchen.

17. Users can create an account on Instagram and customize their profile with a profile picture, bio, and other details.

18. La science des matériaux permet de développer de nouveaux matériaux pour de multiples applications.

19. Limitations can be physical, mental, emotional, financial, or social.

20. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

21. Selain sholat, orang Indonesia juga melakukan doa melalui upacara adat dan keagamaan.

22. Bawal magdadala ng baril sa loob ng paaralan dahil ito ay delikado sa kaligtasan ng mga estudyante.

23. Habang naglalakad, naisip niya na maganda ang ideya na lumibot sa paligid ng kanyang silid-aralan para makahanap ng inspirasyon.

24. Penting untuk memiliki pola pikir yang fleksibel dan terbuka dalam menghadapi tantangan hidup.

25. Es importante educar a los jóvenes sobre los riesgos y peligros del uso de drogas.

26. Napakaraming bunga ng punong ito.

27. The library has a variety of books to choose from, ranging from classics to modern literature.

28. La paciencia es la clave para conseguir lo que deseamos.

29. Ang tindahan ay nasara dahil sa paulit-ulit na pag-suway sa business regulations.

30. Kumain ako ng macadamia nuts.

31. She was named as one of Time magazine's most influential people in the world in 2016 and 2019.

32. Sige.. pupunta tayo sa Jeju Island next March 26..

33. Tumahol ang aso at natakot ang pusa.

34. Waring may bagyong paparating dahil sa biglang pagdilim ng kalangitan.

35. Masakit man aminin, hindi maiiwasan na mag-inis tayo sa mga taong nakapaligid sa atin.

36. Pagkatapos siyang kausapin ng hari ay dumeretso si Nicolas sa simbahan at siya ay nagdasal.

37. Inflation bezieht sich auf die allgemeine Erhöhung der Preise für Waren und Dienstleistungen.

38. The city is a melting pot of diverse cultures and ethnicities, creating a vibrant and multicultural atmosphere.

39. Bigla nya akong hinigit sa kwelyo, Anong sinabi mo?

40. Debemos enfrentar la realidad y no ignorarla.

41. Jeg er helt forelsket i hende. (I'm completely in love with her.)

42.

43. Ang purgatoryo ay nagpapakita ng kahalagahan ng paglilinis at pag-aayos ng kaluluwa bago pumasok sa langit.

44. The park has a variety of trails, suitable for different levels of hikers.

45. Where there's smoke, there's fire.

46. In recent years, the telephone has undergone a major transformation with the rise of mobile phones

47. Ano ang ginagawa niya sa gabi?)

48. It's hard to break into a new social group if you don't share any common interests - birds of the same feather flock together, after all.

49. The Flash can move at superhuman speed, making him the fastest man alive.

50. Naghahanap ako ng mga chord ng kanta ng Bukas Palad sa internet.

Recent Searches

automatisktignaneducationkarangalanshinesteachermatamanisinamakundimanpagsusulitmaskinereksport,sumasakaynaroonsusihundredsinakopmagnifytasapalaydyipinantaybesthuwebessakakinamumuhianhistorykaguluhannitongpanalanginfeedback,namfueespigasexcusenamumukod-tangielvisbook:tinungonyechoicepagekuneleukemiafurystonehamdamitsoonsourcesofficebluemovingfatalplatformsvasquesdaigdigpartnerfuturewithoutbilingclientereadwhichservicestechnologiestelevisedrecentmrsprotegidohanapinpalakainiisipkuwartaalasmukhapalayansalbahehangaringpatulogeksenalumibotforcesagilitysumasayawteachdahilkwenta-kwentapamburaobra-maestranaglalatanglumalangoynananaloerlindanagkwentot-shirtnakakagalakakuwentuhanlibangankahariannakikianamumulotnangyariumagawdisfrutarsinasadyakasintahanberegningerharapanstorypagbigyanre-reviewtagpiangmasaktanmasasabinakabluecleansakophatinggabimaskaranangingilidtransportpakilagaypangambakastilapaliparintindahanininomtengabopolspatongpangako3hrsrecibirmusicianmanipismaingattibigkasakitganitoanongpresyobigyannangangahoyassociationaminutilizarkarapatantuloy-tuloytaingabusiness,nagbasameaningutilizanilinisbusyangsinipangbecomedawsiempreprogramadevelopedbiggestrobotichalljacememorialtotoomalalimmalayadatisumusulatpiratanakakaalamdidinuminagostanda18thenvironmentreleasedbadinginfluenceochandoemphasiscertainevolvedmanagersmallatingaplicaipagtimplabadroquehigitkawili-wilinanghihinamadumakyatnakakatulongpagka-maktolinaamin