Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

11 sentences found for "ideas"

1. Don't worry about making it perfect at this stage - just get your ideas down on paper

2. Einstein's ideas challenged long-held assumptions about the nature of space and time.

3. Emphasis can be used to contrast ideas or draw attention to a particular aspect of a topic.

4. Emphasis is often used to highlight important information or ideas.

5. He was also a philosopher, and his ideas on martial arts, personal development, and the human condition continue to be studied and admired today

6. Here are a few ideas to get you started: Freelancing: If you have a skill that others need, such as writing, graphic design, or programming, you can offer your services as a freelancer

7. In addition to his martial arts skills, Lee was also known for his philosophical ideas and his emphasis on personal development

8. La creatividad es fundamental para el desarrollo de ideas innovadoras.

9. Remember that the most important thing is to get your ideas and message out to the world

10. Research: Depending on the subject of your book, you may need to conduct research to gather information and support your ideas

11. The internet, in particular, has had a profound impact on society, connecting people from all over the world and facilitating the sharing of information and ideas

Random Sentences

1. Arbejdsgivere leder ofte efter erfarne medarbejdere.

2. At være bevidst om vores handlinger og beslutninger kan hjælpe os med at undgå at skade andre og os selv.

3. Dwayne "The Rock" Johnson is a former professional wrestler turned actor, known for his roles in films like "Jumanji" and the "Fast & Furious" franchise.

4. The weatherman said it would be a light shower, but it's definitely more like it's raining cats and dogs.

5. Ilang tao ang nagpapaitim sa beach?

6. Nakatanggap si Nicolas ng sulat galing sa ninanais niyang paaralan, siya ay nakapasa dito.

7. Nakakasama sila sa pagsasaya.

8. The culprit behind the vandalism was eventually caught and held accountable for their actions.

9. Naging kaibigan ko ang aking guro sa Sining dahil sa aming parehong hilig sa art.

10. Dedication is the fuel that keeps us motivated, focused, and committed to achieving our aspirations.

11. Daraan pa nga pala siya kay Taba.

12. Il est tard, je devrais aller me coucher.

13. Esta comida está demasiado picante para mí.

14. Libre ba si Renato sa Huwebes ng gabi?

15. Maaga dumating ang flight namin.

16. Ang pagtugtog ng malamig na musika ay nakatulong sa akin na magrelaks at magkaroon ng matiwasay na isip.

17. Ang mga mamamayan ay nagpahayag ng kanilang mga mungkahi upang maresolba ang mga suliranin sa kanilang barangay.

18. They act as a bridge between their constituents and the government, conveying concerns and advocating for necessary reforms.

19. La formación y la educación son importantes para mejorar las técnicas de los agricultores.

20. Ang edukasyon lamang ang maipapamana ko sayo.

21. Umiling lang ako bilang sagot saka ngumiti sa kanya.

22. She is not drawing a picture at this moment.

23. It is important for individuals experiencing baby fever to communicate their feelings openly with their partner, family, or friends, as they can provide support and understanding.

24. Hendes historie er virkelig fascinerende. (Her story is really fascinating.)

25. El cultivo de frutas tropicales como el plátano y la piña es común en países cálidos.

26. Ailments can have physical symptoms, such as pain, fatigue, or fever, as well as psychological symptoms, such as anxiety or depression.

27. Ehehe. Siya yung boyfriend ko.

28. Si Maria ay nag-aapuhap ng tulong sa kanyang mga kaibigan para sa isang charitable event.

29. La internet nos permite comunicarnos con personas de todo el mundo a través de correo electrónico, redes sociales y otros medios.

30. Napatakbo ako sa kinalalagyan ng landline ng tumunog yun.

31. Bagay na bagay sa kanya ang suot na traje de boda.

32. Der er mange traditionelle ritualer og ceremonier forbundet med at blive kvinde i forskellige kulturer.

33. Tantangan hidup memberikan kesempatan untuk memperluas kemampuan dan meningkatkan kepercayaan diri.

34. Sa gitna ng katahimikan, nakita ko siyang tulala sa kanyang pag-iisip.

35. Limitations can be physical disabilities, such as hearing or vision loss, or mental health conditions, such as anxiety or depression.

36. All these years, I have been building a life that I am proud of.

37. Nous avons prévu une lune de miel en Italie.

38. Nilalakad namin ang mapa para mahanap ang aming pupuntahan.

39. Kung ano ang puno, siya ang bunga.

40. El amor todo lo puede.

41. Omelettes are a popular choice for those following a low-carb or high-protein diet.

42. Magkaiba man tayo ng landas ay tiyak kong magkikita pa din tayo.

43. Ang bango ng lupa pagkatapos ng ulan ay nagdala ng mabango at sariwang simoy.

44. Sino ba talaga ang tatay mo?

45. En invierno, la ropa de invierno, como los abrigos y las botas, está en alta demanda.

46. Ang manunulat ay nagsusulat ng nobela na nagpapakita ng kaniyang malikhain na imahinasyon.

47. Es importante elegir un powerbank de buena calidad para garantizar una carga segura y eficiente.

48. Tweets are limited to 280 characters, promoting concise and direct communication.

49. Les salles d'hôpital sont souvent partagées entre plusieurs patients.

50. Sino ang kinukuha ng mga sundalo?

Recent Searches

binigyangideastechniqueseksenamulti-billionbigfistspostersumapittrackspaactingfinishedleestrategycomeluisflooranumaninfluenceyumakapdyiprelieved1982badingcrazysecarseclientesdarkbitawanbehalfbeginningconnectionredputoldoonmemoryduloneedsbehavioreithermanagermasterplatformbetatechnologiesscaledeclarepersistent,tataybodegacrucialtiniradorcompletenamilipitcallermaihaharapnasasabihanpambansangtopic,maasimtumutubopaglisanpedema-buhaymaisusuotsagasaanpahiramtotoongpagsagotasignaturatalagakunehoobstaclestinungokaliwasumasayawsunud-sunodsankagandahumpaykirotresearch,panunuksomaibadiinvampiresbarnescryptocurrency:pilasorebiroresourcesallowedactormulipapasokvariousipinagbilingeducationalrichginalilipadydelsersementoperseverance,nakapikitmaestrapneumoniajulietdyosaiikotnakukuhakategori,bataikinamataymagtatagalnanlilimahidkonsentrasyonnabalitaannagtatakbokomunikasyonhumiwalaykinatatakutankinatatalungkuanglasingfilmnagpaalamkapangyarihankagalakantuluyanpinabayaanmakikipagbabagnagpapakainmagkaibapaga-alalakinagalitantungawhiwamakatatloinirapannakapaligidmanghikayatentrancenakatuloggagawinmatapobrengmatalinounti-untikamiassulyapkalaunanpinasalamatankabutihanhayaanpagkainisdeliciosahouseholdsdiretsahangpinapaloutak-biyapakikipaglabanilalagaynanunuksokilongbalediktoryansenadornag-emailnakabibingingmagpasalamatkontratahawaiibigongrawtapusinelevatornaiilangpaghaliksinaliksikkalakilinggongtumakasnapapansinninanaishalu-halomaruruminakasunodmagtatakacruznakapagproposetumigilpinalalayaskontinentengsagutinnaglokohanpatakbonai-dialbulakalakgovernorssiopao