Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

11 sentences found for "ideas"

1. Don't worry about making it perfect at this stage - just get your ideas down on paper

2. Einstein's ideas challenged long-held assumptions about the nature of space and time.

3. Emphasis can be used to contrast ideas or draw attention to a particular aspect of a topic.

4. Emphasis is often used to highlight important information or ideas.

5. He was also a philosopher, and his ideas on martial arts, personal development, and the human condition continue to be studied and admired today

6. Here are a few ideas to get you started: Freelancing: If you have a skill that others need, such as writing, graphic design, or programming, you can offer your services as a freelancer

7. In addition to his martial arts skills, Lee was also known for his philosophical ideas and his emphasis on personal development

8. La creatividad es fundamental para el desarrollo de ideas innovadoras.

9. Remember that the most important thing is to get your ideas and message out to the world

10. Research: Depending on the subject of your book, you may need to conduct research to gather information and support your ideas

11. The internet, in particular, has had a profound impact on society, connecting people from all over the world and facilitating the sharing of information and ideas

Random Sentences

1. Los teléfonos móviles también ofrecen una variedad de funciones adicionales, como la capacidad de enviar y recibir mensajes de texto, tomar fotos, acceder a internet y utilizar aplicaciones

2. Ano ang ginawa niya pagkatapos ng giyera?

3. Lazada has a loyalty program called Lazada Wallet, which allows customers to earn cashback and discounts on purchases.

4. Ay shet. Ano ba yun natanong ko. Biglaan.

5.

6. Gayunman, si Cupid ang nabighani sa kagandahan ni Psyche.

7. Pull yourself together and show some professionalism.

8. Les travailleurs doivent souvent se soumettre à une évaluation annuelle de leur performance.

9. Isang araw, napagod na ang mga diwata sa away ng mga mababangis na hayop at mga ibon.

10. It's time to address the elephant in the room and discuss the difficult decisions that need to be made.

11. The United States has a system of separation of powers, where the legislative, executive, and judicial branches operate independently of one another

12. Sa ganang iyo, dapat pa bang bigyan ng pangalawang pagkakataon ang mga nagkasala?

13. Paborito nyang panoorin ang Baby shark sa youtube.

14. Nagpatawag ng pagpupulong ang guro sa silid-aralan upang pag-usapan ang mga plano para sa darating na taon.

15. Saan ka galing? bungad ni Maico saken pagpasok ko s condo.

16. Pinalitan nya ng diaper ang umiiyak na sanggol.

17. La paciencia es la clave para conseguir lo que deseamos.

18. Oscilloscopes come in various types, including analog oscilloscopes and digital oscilloscopes.

19. Matapos ang matagal na relasyon, napagpasyahan niyang mag-iwan at mag-move on.

20. Lumuwas si Fidel ng maynila.

21. Besides, smoking cigarettes means a waste of money, since the habit instead of doing any good only causes injury to one’s health and makes one a slave to the addiction

22. Sang-ayon ako sa opinyon mo tungkol sa pagsasama ng magkaibang relihiyon.

23. Holy Week begins on Palm Sunday, which marks Jesus' triumphal entry into Jerusalem and the start of the Passion narrative.

24. Ihahatid ako ng van sa airport.

25. Oo malungkot din ako. Mamimiss kita.

26. Crush kita simula pa noong nakita kita sa klase natin.

27. If you quit your job in anger, you might burn bridges with your employer and coworkers.

28. Nangahas siyang sumagot sa guro nang hindi nag-iisip, kaya siya napagalitan.

29. Fundamental analysis involves analyzing a company's financial statements and operations to determine its value.

30. El cuaderno de Leonardo da Vinci contiene muchos dibujos y anotaciones sobre sus inventos.

31. Gusto ko ang mga bahaging puno ng aksiyon.

32. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

33. No hay mal que por bien no venga.

34. Cryptocurrency can be used for peer-to-peer transactions without the need for intermediaries.

35. The company's profits took a hefty hit after the economic downturn.

36. No puedo cambiar el pasado, solo puedo aceptarlo con "que sera, sera."

37. La tecnología agrícola ha mejorado la eficiencia y la calidad de la producción de los agricultores.

38. The company's losses were due to the actions of a culprit who had been stealing supplies.

39. Pasensya ka na anak, ang lahat ng ginagawa namin ng iyong ama ay para sa iyo.

40. Pinatawad din naman ni Ana ang mga ito.

41. Nakahug lang siya sa akin, I can feel him..

42. Ang mahal pala ng iPhone, sobra!

43. Eine gute Gewissensentscheidung zu treffen, erfordert oft Mut und Entschlossenheit.

44. Lumiwanag ang silangan sa pagsikat ng araw.

45. Esta comida está demasiado picante para mí.

46. Hindi na sila nasisiyahan sa nagiging asal ng bata.

47. Gaano ka kadalas uminom ng bitamina?

48. Exercise can be tough, but remember: no pain, no gain.

49. Lasinggero ang tatay ni Gabriel.

50. Presley's early career was marked by his unique blend of musical styles, which drew on the influences of gospel, country, and blues

Recent Searches

medyoideasbinatakapoy4thnogensindelendingnawalangtrainingtatlumpungintroduceviewsgandanakasusulasoksinigangkanyaparehasumagapaanakapagproposenahantadblazingnanlilimahidkarnabalcurtainsnakatingingmawalaorugatomaromeletteitinulosnatapossamakatwidisinalangunderholderkalakingmagsabiimagingenforcingkumakalansinginternalwikacubiclecallmakahiramnagsuotnathanmaayosnagdadasalnagtatanimimprovedaga-agagitnalabing-siyamlumayoapollovisualalexanderaaisshkaniyafauxnatatanawkakaibanggawainglamesaklimatahimikhandaladalanatutuwawingasignaturareviewersnanagpartnernasagutanindustriyalaybrarithankmusiciansfilipinamerlindamagbabakasyonhelenamakalaglag-pantypag-aaraldisenyonggumigisingmedya-agwakamandaglumuwassilyamataosumagoteffortsprimerosnangangahoynilangpetermassesdistansyapaidmalumbaybarpagpapakilalapostlordoutsumingitgawaarbejdsstyrkemagasawangkuwartosubject,cancerdiseasecarmenjigssinapanghabambuhayshadespunongkahoyactorkapangyarihanpinigilanmoneymusicnagpapasasaaplicacionesnatitiramatangmaghahabisumangpagkapasokmaskianibersaryomagbabalasinongcomunicarsefulfillmentnagmakaawasinabisumalitechniquesmalilimutankeepgrinsbasahinasthmanutsdontcoaching:carloalas-dosnamilipitmahiwagangsellboksingbaoallottedresignationmalambingextrakainnapakagandanatutulogdon'tdalawampulunasadvancebalingbagopaksaworkdaykartonnapakamotinalissarongstudiedgraphicpropensokuboissuessusunduinbundokalitaptapnakakainconnectionactionuncheckeddataresearch:sobrareadcandidate11pmfindpagpasensyahannyamagpa-checkup