Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

24 sentences found for "best"

1. "Dog is man's best friend."

2. A couple of actors were nominated for the best performance award.

3. Aku sayang dengan pekerjaanku dan selalu berusaha memberikan yang terbaik. (I love my job and always strive to do my best.)

4. All these years, I have been striving to be the best version of myself.

5. Alles Gute! - All the best!

6. Baby fever can be accompanied by increased attention to one's physical health and well-being, as individuals may want to ensure the best conditions for conception and pregnancy.

7. Chris Paul is a skilled playmaker and has consistently been one of the best point guards in the league.

8. Dirk Nowitzki, a 7-foot power forward, is considered one of the best international players in NBA history.

9. Dogs are often referred to as "man's best friend".

10. Hakeem Olajuwon was a dominant center and one of the best shot-blockers in NBA history.

11. Happy birthday to my best friend, I hope you have a wonderful day!

12. Honesty is the best policy.

13. Hugh Jackman is best known for his portrayal of Wolverine in the "X-Men" film series and his Tony Award-winning performance in the musical "The Boy from Oz."

14. I woke up to a text message with birthday wishes from my best friend.

15. If you want to get the best deals at the farmer's market, you have to be the early bird.

16. Karl Malone, also known as "The Mailman," is considered one of the best power forwards in NBA history.

17. Larry Bird was a versatile forward and one of the best shooters in NBA history.

18. Laughter is the best medicine.

19. Los sueños nos dan una razón para levantarnos cada mañana y hacer lo mejor que podemos. (Dreams give us a reason to get up every morning and do our best.)

20. My best friend and I share the same birthday.

21. Read books on writing and publishing, it will help you to gain knowledge on the process and best practices

22. Talaga? aniya. Tumango ako. Yehey! The best ka talaga!

23. We finished the project on time by cutting corners, but it wasn't our best work.

24. Yey! Thank you Jacky! The best ka talaga!

Random Sentences

1. Ang sugal ay isang mapanlinlang na paraan ng pag-asang maaaring magdulot ng pagkabigo at pagkasira sa buhay.

2. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

3. El agua desempeña un papel crucial en el funcionamiento de los ecosistemas.

4. May naghubad na ng damit at isinampay na lamang sa balikat.

5. Heto ho ang isang daang piso.

6. Puwede bang makausap si Maria?

7. Nagmadaling maglakad si Kenji papalapit sa amin ni Lucas

8. Der er mange forskellige typer af helte.

9. The hospital had a special isolation ward for patients with pneumonia.

10. They do yoga in the park.

11. Today we can watch games, shows, and song and dance programs from all corners of the world while sitting in our own homes.

12. Lumapit ang matandang babae at ipinahayag ang kanyang hinagpis dahil sa kawalang-katarungan.

13. Sa bawat Chinese New Year, ang mga tao ay nagbibigay ng mga bagong larawan at dekorasyon upang ipagdiwang ang bagong panimula.

14. They have renovated their kitchen.

15. Ano hong klaseng sawsawan ang gusto ninyo?

16. Ultimately, the concept of God is deeply personal and subjective, with each person's beliefs and experiences shaping their understanding of the divine.

17. Puwede kang magguhit ng mga larawan ng iyong pamilya at kaibigan upang ipakita ang pagmamahal sa kanila.

18. Hindi ako makapaniwala sa nakikita ko.

19. Anong oras natatapos ang pulong?

20. Muchas ciudades tienen museos de arte que exhiben obras de artistas locales e internacionales.

21. We have been cleaning the house for three hours.

22. Kapag nalulong ka na sa droga, mahirap nang makalaya sa hawla nito.

23. Electric cars can be a viable option for individuals who want to reduce their carbon footprint and contribute to a more sustainable future.

24. Sinubukan niyang salatin ang pader sa dilim upang makahanap ng pinto.

25. Time management skills are important for balancing work responsibilities and personal life.

26. Ano ang pangalan mo? ang tanong niya sa bata.

27. He is having a conversation with his friend.

28. Pinahiram ko ang aking costume sa aking kaklase para sa Halloween party.

29. I fell for an April Fool's joke on social media this year - a friend posted a fake news article that was so convincing I thought it was real.

30. Tumindig ang pulis.

31. Los árboles pueden perder sus hojas en invierno, creando un aspecto desnudo y frío.

32. Einstein was awarded the Nobel Prize in Physics in 1921 for his discovery of the law of the photoelectric effect.

33. Ang paggamit ng droga ay hindi lamang masama sa katawan, kundi pati na rin sa isipan.

34. Nagpasya ang salarin na sumuko sa pulisya matapos ang mahabang panlilinlang.

35. Ang aming washing machine ay madalas magamit dahil halos araw-araw kaming naglalaba.

36. Saan pumupunta ang manananggal?

37. If you think she'll forgive you, you're barking up the wrong tree.

38. Ano ang kulay ng paalis nang bus?

39. The restaurant messed up his order, and then the waiter spilled a drink on him. That added insult to injury.

40. Los héroes nos inspiran a ser mejores y nos muestran el poder de la bondad y el sacrificio.

41. Additionally, be aware that not all opportunities on the internet are legitimate, so always do your own research before investing time or money into any opportunity

42. Napuno ako ng poot nang malaman ko ang mga kasinungalingan na ibinato sa akin.

43. Bell's invention was based on the idea of using electrical signals to transmit sound, which was a new concept at the time

44. Sa mapa, makikita mo ang mga pook na may magandang tanawin.

45. Nasa Pilipinas na si Raymond ngayon.

46. Waring may bumisita sa bahay kagabi dahil bukas ang pintuan sa umaga.

47. Sariling pagraranas ang aking pamamagitan.

48. Binentahan ni Aling Maria ng prutas si Katie.

49. Weddings are typically celebrated with family and friends.

50. Natawa kami sa inasta ni Sara dahil para siyang bata.

Similar Words

bestidabestfriendbestido

Recent Searches

bestmartatiyaipinatawagreporteropportunitynapapikitmanatilihonestodetallanprogrammingbinibinimahinapag-iyakpaanakagalawdemmaaaringthreekapamilyaulinamumulaklakmakakasahodnamumuongdetcultivocontrolapasosnakakainumuwiwikapambatangpahiramhoneymoonpacienciamaisusuotrefersmukhangmahalagafulfillingshockinvesting:na-suwaykumikinigconventionalminu-minutonaguguluhangpagsalakaymagpaniwalababadagat-dagatansarapcantidadpangungusapmontrealnakakatabamalapalasyomahahalikhouseholdsinjurynagdadasalabut-abotnapatulalakontingmagturomananaloninanaisorasantemperaturamaabutanfrancisconahahalinhanvidenskabpinangalananglumilipadsinongtig-bebeintetilgangumikotnapansinpakukuluanpinauwitindahanpigilannawalacosechar,jeepneyvedvarendepatawaringatolibabawskillshawaiisabonggymhinalungkatkindergartenbastonkassingulangcommerciallayaskalapicsexcitedpapeldisciplinnovemberbibilhinpauwihuertonangingilidherramientasfiverrtamadangelaganangnasuklamkabarkadakumapitmataaastrajekataganyansumingitambagiigibreviewmalapitanbinilhannatandaanadoptedkinaincombinedoutlinealayuntimelyhojaseducativassumayajoeisinalanggraphicdemocracycassandrajuanginterestsmagsimulaboyetharingbansanahulihearsinunodseeawanagdaramdamditolabingwelladditionayudatanimvampiresbumabababulaklakleadmacadamiabadbareducationalpapuntahardaddresschessannadeclaretelevisedmarkedhimemphasisstagewaysduloclockconditionsmallcontinuedjohnpaanomakalaglag-pantyinaasahangmasungitrailwayshumigadistansyapakistanfotosmaanghangnagliwanagposter