Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

14 sentences found for "behind"

1. Dedication is the driving force behind artists who spend countless hours honing their craft.

2. Haha! Who would care? I'm hiding behind my mask.

3. I know we're behind schedule, but let's not cut corners on safety.

4. Nationalism has been a driving force behind movements for independence and self-determination.

5. The culprit behind the cyberattack on the company's servers was traced back to a foreign country.

6. The culprit behind the data breach was able to exploit a weakness in the company's security.

7. The culprit behind the hit-and-run accident was later caught and charged with vehicular manslaughter.

8. The culprit behind the product recall was found to be a manufacturing defect.

9. The culprit behind the vandalism was eventually caught and held accountable for their actions.

10. The elephant in the room is that the project is behind schedule, and we need to find a way to catch up.

11. The police were searching for the culprit behind the rash of robberies in the area.

12. The police were trying to determine the culprit behind the burglary.

13. The project was behind schedule, and therefore extra resources were allocated.

14. The victim was relieved to finally have closure after the culprit behind the crime was caught and prosecuted.

Random Sentences

1. Helte kan inspirere os til at tage positive handlinger i vores eget liv.

2. Mahalagang mag-ingat sa ating kalusugan, datapapwat ay hindi natin nakikita ang mga mikrobyo at virus na nagdadala ng sakit.

3. Ang kabanata ay nagbigay ng mahahalagang detalye tungkol sa nakaraan ng pangunahing tauhan.

4. Lumalakad siya ngayon na walang-tiyak na patutunguhan.

5. Hindi malaman kung saan nagsuot.

6. He's always telling tall tales, so take his stories with a grain of salt.

7. En el siglo XVII, el Barroco español produjo figuras importantes como Francisco Guerrero y Tomás Luis de Victoria

8. Para el Día de los Enamorados, mi pareja y yo nos fuimos de viaje a un lugar romántico.

9. If you want to maintain good relationships, don't burn bridges with people unnecessarily.

10. Napuno ako ng poot nang malaman ko ang mga kasinungalingan na ibinato sa akin.

11. Magkaiba ang disenyo ng sapatos

12. Ganun talaga. Simpleng sagot ko.

13. Salamat sa alok pero kumain na ako.

14. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

15. Bilang paglilinaw, ang presyo ng produkto ay may kasamang buwis, kaya hindi na ito madadagdagan.

16. Sa sarili, nausal niyang sana'y huwag siya ang maging paksa ng paghaharutan at pagkakatuwaan ng mga agwador.

17. Sa kabilang silid, nagitla ako nang biglang sumigaw ang aking kaibigan.

18. Mi aspiración es hacer una diferencia positiva en la vida de las personas a través de mi trabajo. (My aspiration is to make a positive difference in people's lives through my work.)

19. Nasa Ilocos si Tess sa Disyembre.

20. Las escuelas también ofrecen programas de apoyo, como tutorías y asesoramiento académico.

21. Ano-ano ang mga projects nila?

22. La paciencia es necesaria para alcanzar nuestros sueños.

23. Mahalaga ang papel ng edukasyon sa pagpapalawig ng kaalaman at oportunidad para sa sektor ng anak-pawis.

24. Napakaganda ng loob ng kweba.

25. Marami pa siyang mga pangarap sa buhay at kailangan ko pa po siya.

26. La science des matériaux permet de développer de nouveaux matériaux pour de multiples applications.

27.

28. It is one of the most important inventions in human history, as it has revolutionized the way we communicate and has played a crucial role in shaping modern society

29. Nang natapos ang araw ng pagsusulit, gumawa ng paraan ang binata para makabawi sa dalaga.

30. Kapag nagkakasama-sama ang pamilya, malakas ang kapangyarihan.

31. Anong ginagawa mo?! mataray pang sabi nito.

32. Sumapit ang isang matinding tagtuyot sa lugar.

33. Ang mga bayani ng kasaysayan ay dapat na itinuring at ipinagbunyi bilang mga pambansang tagapagtanggol at inspirasyon.

34. Bumaba na sila ng bundok matapos ang ilang oras.

35. Nasa Massachusetts ang Stoneham.

36. Dahil ang alam lang ay kumain, hindi alam ni Ranay kung paano ma-buhay na siya ang kikilos at magta-trabaho.

37. May bagong dokumentaryo na ginawa ukol kay Apolinario Mabini.

38. Tumingin siya sa akin, waring may nais siyang ipahiwatig.

39. Binuksan ko ito at binasa yung nakalagay.

40. Cancer awareness campaigns and advocacy efforts aim to raise awareness, promote early detection, and support cancer patients and their families.

41. Pinayuhan siya ng doktor tungkol sa pangangalaga sa bungang-araw.

42. Sumasakit na naman ang aking ngipin.

43. My favorite April Fool's joke of all time was the time my cousin convinced her entire family that she had won the lottery.

44. They are not cooking together tonight.

45. Ang digmaan ay maaaring magdulot ng pagbabago sa pamamahala ng isang bansa.

46. Saan-saan kayo pumunta noong summer?

47. Pagod na ako at nagugutom siya.

48. Matagumpay na nagwagi si Wesley laban sa kasalukuyang kampeon ng boxing.

49. The field of entertainment has also been greatly impacted by technology

50. James K. Polk, the eleventh president of the United States, served from 1845 to 1849 and oversaw the Mexican-American War, which resulted in the acquisition of significant territory for the United States.

Recent Searches

behindnakagawiannakapapasongkahitkailantrentamaglalakadnahulaanmisteryoadvancescassandraipinaonlywednesdaykaninkawalsana-allrebolusyonpetroleumaidtugonsakinusakinakabahanhulihandioxidegamitingurokarangalangitnawinskitangmalihissakupinnagmistulangefficientkagipitannagsusulatmagpagupithumabihumahangoskasinagandahanbagalpagngititravelernakikilalangkahirapanmagkahawakpinagmamalakinangagsipagkantahannailigtasjuegosnakakatandatiktok,pahiramnabighanigumawanaiisipgumagamittaga-hiroshimahitatinutopunahinnapapasayaliv,nag-uumiribefolkningen,kinikilalangnakapagsabimanggagalingnakitagifthawaiikommunikerernagtataelondonumagawmanirahangawinpaghaliknangyaritherapeuticsdiyandadalawnearnakakaanimregulering,renacentistaopisinabuwenasinventedkirbyuwakmaibigaymarangalpigilantanghalitsonggogatasmahahawanatitiyaknakauslingwakasentertainmenthumiganatuloykaybilisgatolnewspapersnaglulusakmetodiskiniangatibilitibigpangilkutsilyonapapikitnararapatkasoymayamangarkilasalesiniisippa-dayagonalitokamitasaadobomakahingimedyoginawaparurusahanpigingvetooutlinegabrielkriskakulangrabegamotspentcontent,bataylingidgivemakisigawayepcupidcharmingmataaspatisamakatwiddyipniligawannapatingalaparodalawabutihingtinurohmmmaniyabevaredangerous1935ninariskavailableprosperdaanleukemiasubjectabinilangfreelancerstarestablishnagpaalamsayobaldeoperategenerationerdaddyataqueseducationalbakeearlyiconinisagilityandrepracticesincludeandroidinspiredincreasedwhycommunicatenamunga