Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

14 sentences found for "behind"

1. Dedication is the driving force behind artists who spend countless hours honing their craft.

2. Haha! Who would care? I'm hiding behind my mask.

3. I know we're behind schedule, but let's not cut corners on safety.

4. Nationalism has been a driving force behind movements for independence and self-determination.

5. The culprit behind the cyberattack on the company's servers was traced back to a foreign country.

6. The culprit behind the data breach was able to exploit a weakness in the company's security.

7. The culprit behind the hit-and-run accident was later caught and charged with vehicular manslaughter.

8. The culprit behind the product recall was found to be a manufacturing defect.

9. The culprit behind the vandalism was eventually caught and held accountable for their actions.

10. The elephant in the room is that the project is behind schedule, and we need to find a way to catch up.

11. The police were searching for the culprit behind the rash of robberies in the area.

12. The police were trying to determine the culprit behind the burglary.

13. The project was behind schedule, and therefore extra resources were allocated.

14. The victim was relieved to finally have closure after the culprit behind the crime was caught and prosecuted.

Random Sentences

1. Alam na niya ang mga iyon.

2. Ayam goreng adalah ayam yang digoreng dengan bumbu khas Indonesia hingga renyah.

3. Nalaman ko na ang kanyang halinghing ay dahil sa kanyang asthma.

4. He appointed three Supreme Court justices during his presidency, shaping the ideological balance of the court.

5. The Lakers have a large and passionate fan base, often referred to as the "Laker Nation," who show unwavering support for the team.

6. Nagpapantal ka pag nakainom remember?

7. Gaano ko kadalas dapat inumin ang gamot?

8. The symptoms of pneumonia include cough, fever, and shortness of breath.

9. Ah salamat na lang, pero kelangan ko na talagang umuwi.

10. Elvis Presley's life and career are a fascinating story of a young man who rose from humble beginnings to become one of the biggest stars in the world

11. Napakainit ngayon kaya't kinailangan kong nagiigib ng malamig na tubig para sa sarili ko.

12. Ito ang nabigkas ni Waldo, mga katagang mula sa kanyang puso na punong-puno ng hinanakit.

13. His speech emphasized the importance of being charitable in thought and action.

14. Fleksibilitetstræning, såsom yoga og strækning, kan hjælpe med at forbedre bevægeligheden og reducere risikoen for skader.

15. He admires his friend's musical talent and creativity.

16. I have been jogging every day for a week.

17. It’s risky to eat raw seafood if it’s not prepared properly.

18. Las escuelas ofrecen actividades extracurriculares, como deportes y clubes estudiantiles.

19. Det har også ændret måden, vi underholder os og håndterer vores daglige opgaver

20. Umuwi na tayo satin.. naramdaman ko ang pagtango niya

21. Ang ganda ng bagong laptop ni Maria.

22. Selamat ulang tahun! - Happy birthday!

23. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

24. Wait lang ha, sasagutin ko na baka importante eh.

25. What goes around, comes around.

26. Tumama ang aming kapitbahay sa lotto.

27. Sa tapat ng tarangkahan, may malalaking bulaklak na de-korasyon.

28. Hinahangad ko na makatapos ng yoga session nang hindi naghihingalo.

29. La conciencia es una herramienta importante para tomar decisiones éticas y morales en la vida.

30. Los recién nacidos son pequeños y frágiles, pero llenan nuestros corazones de amor.

31. Huwag ka nanag magbibilad.

32. Walang makakibo sa mga agwador.

33. He was also a philosopher, and his ideas on martial arts, personal development, and the human condition continue to be studied and admired today

34. He had a bad day at work, and then he got a parking ticket. That just added insult to injury.

35. Hinde pa naman huli ang lahat diba?

36. Tumayo siya tapos humarap sa akin.

37. Sa bawat pagkakamali, mayroong aral na pwedeng matutunan, samakatuwid.

38. "A dog wags its tail with its heart."

39. Sa bawat kumpetisyon, ipinapakita ni Carlos Yulo ang kahusayan at disiplina ng isang atletang Pilipino.

40. You need to pull yourself together and face the reality of the situation.

41. Tumingin muna si Tarcila sa asawa at...

42. Sa pagkamatay ng aming alagang aso, kami ay lubos na ikinalulungkot.

43. Maagapan natin ang walang humpay na paghaba ng kaniyang buhok, subalit hindi na natin maibabalik ang normal na kapal nito.

44. Maluwag ang parisukat na sementong kinatitirikan ng gripo at ang dulo ng pila'y nasa labas pa niyon.

45. Ailments can impact different organs and systems in the body, such as the respiratory system or cardiovascular system.

46. Las escuelas pueden ofrecer programas de intercambio estudiantil para estudiantes internacionales.

47. Ang saranggola ni Pedro ay mas mataas kaysa sa iba.

48. Natayo ang bahay noong 1980.

49. The patient was referred to a specialist in leukemia treatment for further evaluation and care.

50. Der er mange forskellige typer af helte.

Recent Searches

endviewsipapainitsecarseupworkbehindderginamotsumugodperfecti-markumagapagpapasakittagaaddingvisualleadprogresstutorialsbilingilingfutureinfinitydifferentconvertingsigaresortailmentslamanhealthierlumalangoypitumpongkumikilosreserbasyonkamakailannangangalitniyanpwedengself-defensekadalastenniskinalalagyanfatnagmasid-masidsinasabinakasakittilgangnagsilapittog,elitenagpapanggapdiagnosestherapeuticsmadadalahinugotlinaminahankontra1000binibilisikipeksportenpanalanginkombinationbilitokyosawsawangoshmaranasansectionscarsrichmaaariaudienceinulitusaindividualsinunodwatchingadditionditosumapitnanamansmalledit:maayosinakyatnapailalimabovenaghatidmaritesnakayukomaglalakadmagbantaypagtataasnapakagandadugoinilistarektanggulopinigilanmaistaximauuponahigitanganapingumigisinglagnatnahihirapankinalakihannatatawamahalmahabolindustriyaalagangmagbabalaadvancementfollowingtaksiresearch,nandiyanagilasongserhvervslivetsections,upokutodnochelasamatitigaspuedenmulighederbumabahainomtonightrosahalaganaglinisshowsaidmaitimaalisyumaniglarryutilizaneropressbranchesmapapamadulasnapilingcirclecandidatekalayaanfulfillmentmagkabilangiligtasna-curiousnasilawtelecomunicacionesbahagyabinge-watchinggawainpinangaralansmokeshortkasaysayanpoliticalpagkakatayonangagsipagkantahanpagkakapagsalitaposporonagmamaktolnapakatagalnagpapaigibnakapagreklamomagbabakasyonpunongkahoymagkahawaknagsisipag-uwianmagtanimmagazinesnagkapilatpaglalaitnagsasagotpinakabatanganibersaryopapanhikpinapakiramdamansikre,stonakumbinsikikitaadditionally,medicalmagturotv-showsnaiisipnapatulalangumiwikidkiran