Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

4 sentences found for "legend"

1. He will always be remembered as a legend who brought martial arts to the mainstream and changed the way the world looked at martial arts forever

2. Naniniwala ka ba sa legend ng academy?

3. Tantanan mo ako sa legend legend na yan! hahaha!

4. The legend of Santa Claus, a beloved figure associated with Christmas, evolved from the story of Saint Nicholas, a Christian bishop known for his generosity and kindness.

Random Sentences

1. Sorry.. pati ikaw nadadamay. E-explain ko na lang sa kanya..

2. Kumakain ka ba ng maanghang na pagkain?

3. Hindi ako makapaniwala na datapapwat ay nangyari ang ganitong kaguluhan sa aming lugar.

4. Gusto ko ng tahimik na kuwarto.

5. Napansin ng mga paslit ang nagniningning na baston ng matanda.

6. Ang pakikinig sa mahinahong agos ng ilog ay nagbibigay sa akin ng isang matiwasay na pakiramdam ng kalma at katahimikan.

7. Einstein's contributions to science have had significant implications for our understanding of the universe and our place in it.

8. Representatives engage in negotiations and compromise to find common ground and reach consensus on complex issues.

9. Twitter allows users to send direct messages (DMs) to each other for private conversations.

10. Ang pagtanggap ng tubig-ulan ay isa sa mga pamamaraan ng pagtitipid ng tubig sa panahon ng tagtuyot.

11. Hindi pa nga ako nagtatanghalian eh.

12. Sa tuwing binabalewala ako ng ibang tao, naglalabas ako ng malalim na himutok sa loob ng aking puso.

13. Oscilloscopes can be connected to a computer or network for data logging, remote control, and analysis.

14. Pupunta si Mario sa tabing-dagat sa hapon.

15. Ano ang nasa tapat ng ospital?

16. She admires her mentor's leadership skills and work ethic.

17. Nanghihinamad at naghihikab na iniunat ang mahahabang kamay.

18. Guten Morgen! - Good morning!

19. Lazada is headquartered in Singapore and has operations in Indonesia, Malaysia, the Philippines, Singapore, Thailand, and Vietnam.

20. Put all your eggs in one basket

21. Sa edad na 35, si Rizal ay pinatay sa pamamagitan ng pagsasalang ng baril sa Luneta Park noong Disyembre 30, 1896.

22. Tiyak na may isda kang mahuhuli! Sige, layas! Layas! pinagtulakan ni Kablan ang kaawa-awang matanda na napasubsob sa tarangkahan ng malaking bahay.

23. Hindi ako sang-ayon sa mga desisyon ng aking mga magulang tungkol sa aking buhay.

24. La visualisation et la réflexion sur ses réussites passées peuvent également aider à maintenir la motivation.

25. Børn bør lære om bæredygtighed og miljøbeskyttelse for at bevare vores planet.

26. Trump's rhetoric and communication style were often unconventional and garnered both passionate support and strong opposition.

27. Samvittigheden kan være en påmindelse om vores personlige værdier og moralske standarder.

28. These films helped to further cement Presley's status as a cultural icon and helped to solidify his place in the history of American entertainment

29. This allows people to see their leaders and candidates in action, and it also allows for a more transparent political process

30. Tila ibig nang matuklap ang balat sa kanyang batok, likod at balikat.

31. Kumanan po kayo sa Masaya street.

32. Durante las vacaciones, me gusta relajarme en la playa.

33. Keep in mind that making money online takes time, effort, and patience

34. Magdala ka ng pampaganda mamayang gabi.

35. Stop beating around the bush and tell me what's really going on.

36. Facebook Messenger is a standalone messaging app that allows users to have private conversations with friends and contacts.

37. Limitations can be overcome through perseverance, determination, and resourcefulness.

38. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

39. Oscilloscopes have various controls, such as vertical and horizontal scaling, timebase adjustments, and trigger settings.

40. Understanding the biology of viruses is critical to developing effective treatments and vaccines, and to preventing future pandemics.

41. Ang mahal ng bili nya sa cellphone.

42. Sa isang iglap ay nakalabas sa madilim na kulungan ang Buto.

43. Magkano ho ang arkila ng bisikleta?

44. Limitations can be viewed as opportunities for growth and personal development.

45. Einstein was an accomplished violinist and often played music with friends and colleagues.

46. Sa Chinese New Year, ang mga tao ay nagbibigay ng mga pabuya upang pasayahin ang mga diyos at mga espiritu.

47. She admires the bravery of activists who fight for social justice.

48. Los niños de familias pobres a menudo no tienen acceso a una nutrición adecuada.

49. La comida mexicana suele ser muy picante.

50. Kobe Bryant was known for his incredible scoring ability and fierce competitiveness.

Similar Words

legendslegendary

Recent Searches

legendkirotinalalasinabinalalaromediumaguanakasabitmaninirahanpagpasensyahanvidtstraktarabiamestaplicarutak-biyatrasciendethereforelindolmatandang-matandamag-anakpelikulabilhinbedsbabakamingtataaskahuluganreportermagpakaramipangetinimbitahumanapmaaksidenteinspireiiwankauntitulisang-dagatlovemayorsumayawumiyakmalapitrizalgupitkalayuaneksport,offerfonosmandirigmangnararamdamanpag-aagwadorkatutubolumangoypinagmasdanniyangpasaherotaraiyongpaanoilihimkumakainkinuhamorninggayunmanburolblusacitizensapilitangconectadosletterstorworldmaghugasbahatag-ulanilognagwelgadivisoriacompletewaiterngunitclassroompagkahapobantulotputinagsisikainpagkakatayosignificantnakakainmeetingincluirfauxundeniablenapatayoibinaontumunogtantananmakahingidayspanatilihinabundantesilanapakagalingmaagacultivokikotahanangalaanguitarramatatagpacesarilingcigarettesnagandahankapatidnasilawsapagkatnakakuhanapahintoatinlagunapusongaloknababasatungkolpintonangyayariika-50discoveredinakyatzebrainaantaysinehanmaratingannanakasusulasokbigkiscertainsalu-salojohnsystembelievedcomputerskutiskaagadsubjectpaki-chargeyourkartongpananakopnag-aagawankotsengfeelingamokaybilisnasaanggustingsuotrhythmpangkatdoktormumuraawitankasikamalianhubad-baronoblemaghahandaninumanbeginningpaguutosre-reviewmag-iikasiyammagkikitaikinamatayfremstillesumungawbaonibinentaredesreviewersnagbentakaraokeikinuwentokainisrebolusyonnaglokobalinglegendslearnpamahalaanawarepagkalungkotumaagoseducationsugalipinagbibilinatayodivides1980