Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

3 sentences found for "reduced"

1. Quitting smoking can also lead to improved breathing, better oral health, and reduced risk of premature aging.

2. Smoking cessation can lead to improved mental health outcomes, such as reduced anxiety and depression symptoms.

3. The development of vaccines and antibiotics has greatly reduced the incidence of infectious diseases, while the use of medical imaging and diagnostic tools has improved the accuracy and speed of diagnoses

Random Sentences

1. Ang maniwala sa sabi-sabi, walang bait sa sarili.

2. Las hojas de mi cuaderno están llenas de garabatos y notas.

3. Ikaw ay magiging isang nilalang sa karagatan.

4. She draws pictures in her notebook.

5. Ang yaman naman nila.

6. He has been writing a novel for six months.

7. La realidad es a menudo más compleja de lo que parece.

8. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

9. Frohe Weihnachten! - Merry Christmas!

10. Ang talumpati ng senador ay ukol sa mga reporma sa edukasyon.

11. Sa buong buwan ng Disyembre, ang mga mall ay hitik sa mga pamaskong dekorasyon at mga regalo.

12. Holy Week culminates in the celebration of Easter Sunday, when Christians gather to commemorate the resurrection of Jesus and the triumph of life over death.

13. Tumingin siya sa wrist watch niya saka nag-isip.

14. At habang itinatapat nito ang balde sa gripo, muli niyang nakita na nginingisihan siya nito.

15. Napatingin ako sa kanya, Bakit naman?

16. Sasabihin ko na talaga sa kanya.

17. The company burned bridges with its customers by providing poor service and low-quality products.

18. Madalas banggitin si Carlos Yulo sa mga balita tuwing may malaking kompetisyon.

19. Elektronisk udstyr kan hjælpe med at optimere produktionsprocesser og reducere omkostninger.

20. The website's content is engaging and informative, making it a great resource for users.

21. Inilagay nya sa poon ang biniling sampaguita.

22. Marami ang nag-aadmire sa talambuhay ni Gabriela Silang bilang isang babaeng mandirigma at lider ng rebolusyon.

23. Dogs are often referred to as "man's best friend".

24. Nagitla ako nang biglang tumunog ang emergency alarm sa opisina.

25. Ang bata ay takot na nakatingin sa kanya.

26. Los granjeros deben estar atentos al clima para saber cuándo es el mejor momento para cosechar.

27. Lumuwas si Fidel ng maynila.

28. Ang laki ng wedding cake na ginawa ng kanyang ate.

29. Ang mailap na kaharian ay kailangan paghirapan upang mapasakamay.

30. Gusto ko sanang bumili ng bahay.

31. The website's contact page has a form that users can fill out to get in touch with the team.

32. Leonardo DiCaprio received critical acclaim for his performances in movies like "Titanic" and "The Revenant," for which he won an Oscar.

33. Hindi madaling mahuli ang mailap na pag-asa.

34. La tos puede ser un síntoma de cáncer de pulmón.

35. From: Beast Nasaan ka? Bakit di mo ako hinintay?

36. Uuwi si Ellen sa Cebu sa Pasko.

37. Kevin Garnett was a versatile power forward who brought intensity and defensive prowess to the court.

38. Electric cars can provide a smoother and more responsive driving experience due to their instant torque.

39. Sino ang doktor ni Tita Beth?

40. But the point is that research in the field of the development of new energy sources must be carried on further and expedited so that the exhaustion of conventional sources of power does not adversely affect the growth of our economy and the progress of civilization

41. He is widely considered to be one of the most important figures in the history of rock and roll and has had a lasting impact on American culture

42. Wag na sabi, wag kang magsayang ng gas maraming nagugutom!

43. He plays chess with his friends.

44. Nabigkas ni Tarcila ang mahiwagang kataga bago nalagutan ng hininga sina Lala, Dada at Sasa kaya sa isang kisapmata ang tatlong dalaga ay naging ISDA!

45. Inakalang ligtas ang lugar, pero may paparating palang bagyo.

46. Si Maria ay nagpapahiram ng kanyang mga damit sa kanyang mga kaibigan.

47. They have renovated their kitchen.

48. Television also plays an important role in politics

49. Investing refers to the process of allocating resources with the expectation of generating a profit.

50. Limitations are a part of life, and how one approaches and overcomes them can shape their character and experiences.

Recent Searches

reducedspecialgustoseekiniinombangknowsmarahasdevelopmentsolidifyshiftyeahwhethermulingvanclienteskillbasabathalaflyworkdayemphasispinagawamag-uusappaghalakhakselamadamibarongnakalipascitizendikyamtahanannagkasunoganicreditgabemalimittatawagmagkasamangmatutuwacrecerdumaantumamakabutihankaano-anopinapakiramdamansasapakinpanguloinuunahanelectionsgrowmanatilimagbayadsuchdoktorownsunud-sunuranyorksinisiraparagraphslumindolsumusulatnagmungkahimakipagkaibigansamakatuwidkapatawaranpangungutyalungsodtsakalawakauntingrelomahahanaymarurumimagkamalimaawaingaeroplanes-allnatulakayawnakabaonnaubosdistancepamumunobalahibohinagisahaskangitanulingfredobviousbitiwancantokumukulonakatitigpag-itimmakainmaglababroadcastsmaghihintaypaliparininhalebayadpahingalmatchingsurroundingskambingnasahodnicenapabalitamapagkatiwalaansinecapacidadesdisensyosumungawcorporationmalasmurangblessclientsprogrammingdoingadaptabilityglobalisasyonbakitnakalagaysarongusalahatdisenyongnagbababaevolvemagkaibanginformationpagsasayaanakpelikulaaplicacionesestasyonnakabawiromeroproductividadmasayang-masayaemocionalnakakarinigalbularyooffentligedireksyonmatipunowinstakbonangangakosinongunibersidadhiniritakoginagawapatuloynapipilitanutaksukatinrailkilokapagkinaressourcernewaystalinocirclepinagsasabinagyayangboypaninigasshortnatagolumakingsalitaabanganinantokbultu-bultongpilingibinigaynakakapuntasementeryomonetizingberkeleymagsunogtangeksinangbumagsakbutihingaletomorrowmagkasabayrecentbilibmagalingmatababolanaghihikabluto