Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "rich"

1. Antioxidant-rich foods, such as berries and leafy greens, can help prevent chronic diseases.

2. Calcium-rich foods, such as dairy products and tofu, are important for bone health.

3. Football has a rich history and cultural significance, with many traditions and customs associated with the sport.

4. Hockey has a rich history and cultural significance, with many traditions and customs associated with the sport.

5. I love the combination of rich chocolate cake and creamy frosting.

6. Nutrient-rich foods are fundamental to maintaining a healthy body.

7. Television has a rich history, and its impact on society is far-reaching and complex

8. The Lakers have a rich history and are one of the most successful franchises in NBA history.

9. The United States has a rich history, including the founding of the country, the Civil War, and the Civil Rights Movement.

Random Sentences

1. Ang abuso sa kapangyarihan ay nagdulot ng katiwalian sa pamahalaan.

2. Baby fever can also be influenced by societal and cultural norms, as well as personal experiences and values.

3. Anong ginagawa mo?! mataray pang sabi nito.

4. Skolegang er en vigtig del af børns opvækst og udvikling.

5. Football is known for its intense rivalries and passionate fan culture.

6. She burned the dinner and then the smoke alarm went off. That just added insult to injury.

7. She had been studying hard and therefore received an A on her exam.

8. The dedication of parents is evident in the love and care they provide for their children.

9. Hindi ko nais makialam, ngunit sa ganang iyo, tama ba ang naging hatol ng hukuman?

10. Natutuwa siya sa husay ng kanyang naisip.

11. Naging masyadong mayabang ang bata at nararapat daw itong parusahan.

12. People experiencing baby fever may find themselves daydreaming about pregnancy, childbirth, and the joys of raising a child.

13. Hihiramin ko sana ang iyong kopya ng libro para sa aking assignment.

14. Las hierbas como el jengibre y la cúrcuma tienen propiedades antiinflamatorias y antioxidantes.

15.

16. Disente naman talaga ang kanilang pamilya.

17. Dancing all night at the club left me feeling euphoric and full of energy.

18. Hockey requires a combination of physical and mental skills, including speed, agility, strength, and strategic thinking.

19. Ang daming pulubi sa Luneta.

20. Wer im Glashaus sitzt, sollte nicht mit Steinen werfen.

21. Many wives have to juggle multiple responsibilities, including work, childcare, and household chores.

22. Ako ngayo'y lumilipad at nasa langit na.

23. Gracias por tu ayuda, realmente lo aprecio.

24. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

25. Para el Día de los Enamorados, mi pareja y yo nos fuimos de viaje a un lugar romántico.

26. Magandang umaga po. Ako po si Katie.

27. Uno de los festivales de música más importantes de España es el Festival de San Sebastián, que se celebra en septiembre y cuenta con la participación de artistas de renombre internacional

28. Pumunta ka dito para magkita tayo.

29. Sa mga huling taon, yumabong ang turismo sa lugar na ito dahil sa mga magagandang tanawin.

30. All these years, I have been cherishing the relationships and connections that matter most to me.

31. Ang ilalim ng kanyang payong ay nagsilbing lilim mula sa malakas na sikat ng araw.

32. Ini sangat enak! - This is very delicious!

33. Zachary Taylor, the twelfth president of the United States, served from 1849 to 1850 and died while in office.

34. Umalis siya sa klase nang maaga.

35. Many workplaces prioritize diversity, equity, and inclusion to create a more welcoming and supportive environment for all employees.

36. ¡Muchas gracias por el regalo!

37. Maingay ang bagong taon sa Pilipinas.

38. Bien que le jeu en ligne puisse être pratique, il est également important de prendre en compte les risques impliqués, tels que la fraude et le vol d'identité.

39. Hindi dapat magbigay ng halaga sa mga kababawang bagay tulad ng kasikatan o kasikatan ng mga gamit.

40. Mahirap magluto ng pulotgata dahil kailangan ng tamang timpla.

41. Mahirap makipag-usap sa mga taong mailap at misteryoso.

42. Dogs can provide a sense of security and protection to their owners.

43. Ang gusto sana namin ay dalawang double beds.

44. Scissors can have straight blades or curved blades, depending on the intended use.

45. Kaya't iyon ang naging dahilan kung bakit kinamumuhian niya ang kanayang ama at itinuring na patay na ito

46. Sa pag-aaral ng mga palaisipan, mahalagang maging mapanuri at malikhain upang malutas ang suliranin.

47. Riega el maíz regularmente y asegúrate de que el suelo esté siempre húmedo

48. Paglalayag sa malawak na dagat,

49. Sa labis na pagkagalit ipinadakip mismo ng datu sa mga nasasakupan ang misyunerong nangangaral.

50. Nakasama umano sa listahan ng mga apektado ang ilang barangay sa lungsod.

Recent Searches

richbinyagangdiliginkarangalantrainingteamochandomatandang-matandadaddyipinagbilinginfluentialseafloornotnapuyatmalayoskillpinaggagagawaqualityneverslaveprotestaflycrazycrosslolonagbalikevolvedeffectlockdowndifferentcontrolaconditionedit:platformconsidersetsyungsalamangkerosementeryohumalolapistinanongnakabaliklimosformstayblessmagkasintahanisuothahahaarmedtilitapeumiilingtipsumimangotnatutuloggurohasmag-asawanggrewsusundoinventadoipaghugaskinakaligligpakisabicultivationnaiwangbedsidetawagpnilitpagkatbatiiskedyulmagtipidreturnedperyahansasapakinnakasimangotnagpatulongdresscapitalpedromatatawagjamesbuwalbaduyfigurecadenaluisaggressionpagkaraa1970sbaryoshowerkikonabigyanpeternakagalawikinalulungkotbisikletawowobstaclesbarungbarongmamahalinkelanmahalagacancerspentworkshopmilyongnamumuongkanayonabenabatayphilosophervideotusindvispusingsandalingregularspeednagkakatipun-tiponnandiyanandtarcilakalantitsernaintindihannag-googleabuhingkatamtamanlibanganaguahearmadalaslumapit1954babeitinaobuulitmangungudngodofficepinakamasayananinirahanmakapasokpaosrenecountlessplaysisinakripisyopandemyamangahashamonpaga-alalasiopaomag-ingatlibingjuanclaseshumanofollowing,technologicaldedication,nakikitarolepersonmabirotsonggodispositivoputahepilapinahalatasameadecuadonakangitingtruemakatulongpagkalipaspelikulamensdingdingjeepneytrabajaronceestablishnahawacirclewouldteleviewingfatalsections,pasensiyacornersroofstockfaultisinisigawsedentarylawa