Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "curtains"

1. And often through my curtains peep

Random Sentences

1. Ang mainit na tasa ng tsokolate ay animo'y nagbibigay init sa malamig na gabi.

2. She admires the philanthropy work of the famous billionaire.

3. Hindi ko naiintindihan kung bakit nila gustong gawin ito kaya ako ay tumututol.

4. Women's rights movements have fought for gender equality and greater opportunities for women.

5. Lack of progress or slow progress towards a goal can also be a source of frustration.

6. Mas maliit ang bag ko sa bag ni Cassandra.

7. Børn har brug for at lære om kulturelle forskelle og respekt for mangfoldighed.

8. Lumiwanag ang langit pagkaraang umalis ang ulan.

9. Parehas na galing sa angkan ng mga mahuhusay humabi ang mag-asawa.

10. Gusto ko lang ng kaunting pagkain.

11. Napunit ang papel ng saranggola dahil sa malakas na hangin.

12. George Washington was the first president of the United States and served from 1789 to 1797.

13. Ailments can be caused by various factors, such as genetics, environmental factors, lifestyle choices, and infections.

14. Ang mga salitang mapusok ng kundiman ay naglalarawan ng pagnanasa at pagsisigaw ng pusong umiibig.

15. Les enseignants peuvent dispenser des cours de rattrapage pour les élèves qui ont des difficultés à suivre les cours.

16. Ang palay ay hindi bumubukadkad kung walang alon.

17. The singer's performance was so good that it left the audience feeling euphoric.

18. Nagitla ako nang biglang nag-crash ang kompyuter at nawala ang lahat ng aking trabaho.

19. Scientific research has led to the development of life-saving medical treatments and technologies.

20. Nagkaroon ng malubhang aksidente sa konstruksyon kung saan namatay ang ilang manggagawa.

21. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

22. Di pa namin napapag-usapan yan 'My.

23. Hi Gelai!! kamusta naman ang paborito kong pamangkin?

24. Oo. Tatawagan ka daw niya pag nandyan na siya.

25. Tweets are limited to 280 characters, promoting concise and direct communication.

26. Pasensya na, masama ang pakiramdam ko.

27. Wala kang sapat na pera para sa bakasyon? Kung gayon, ipagpaliban mo muna ito.

28. Nanghihinamad at naghihikab na iniunat ang mahahabang kamay.

29. Una conciencia clara nos da la fuerza y la confianza para hacer lo correcto.

30. Libre ba si Carol sa Martes ng gabi?

31. Grande married Dalton Gomez, a real estate agent, in May 2021 in a private ceremony.

32. Maliit lang ang kusina ni Lola Oliva.

33. The United States has a system of separation of powers, where the legislative, executive, and judicial branches operate independently of one another

34. Gusto mo ba ng isa pang tasa ng kape?

35.

36. Tumugtog si Jemi ng piyano kahapon.

37. Hindi ko alam kung paano ko sasabihin, pero crush kita.

38. In conclusion, making a book is a creative and fulfilling process that requires planning, research, and hard work

39. Tesla vehicles are known for their acceleration and performance, with the Model S being one of the quickest production cars in the world.

40. Wag ka nang malumbay dahil nandito naman ako.

41. Her music career took off with her debut album Yours Truly in 2013, featuring the hit single "The Way."

42. "Kung walang tiyaga, walang nilaga" ay isang bukambibig na nagpapahayag ng katotohanan na ang kakulangan ng pasensya at pagsisikap ay magdudulot ng kawalan ng tagumpay.

43. Emphasis can be used to persuade and influence others.

44. Ang mga mamamayan ay nagpahayag ng kanilang mga mungkahi upang maresolba ang mga suliranin sa kanilang barangay.

45. Nahuli ang magnanakaw ng mga sibilyan at iniharap ito sa mga pulis.

46. The hotel might offer free breakfast, but there's no such thing as a free lunch - the price of the room is probably higher to compensate.

47. Eine schwere Last auf dem Gewissen kann uns belasten und unser Wohlbefinden beeinträchtigen.

48. My coworkers and I decided to pull an April Fool's prank on our boss by covering his office in post-it notes.

49. Mathematics provides a universal language for communication between people of different cultures and backgrounds.

50. True forgiveness involves genuine empathy and a willingness to see the humanity and potential for change in others.

Recent Searches

katolikomalasutlacurtainsnatanggaphinintayreadersarghupoburmapalapit1876grinsxixcinemournedgoodeveningopoasthmascottishbingiapelyidopaligsahanshowsstillfertilizerwidespreaddyanleocivilizationcardiganricagenerationermurangsumalitabasscientistipinabalikfiguresginisingrinplanrelativelythroughoutpasswordbadagilitysagingsinceriyannagventawhyappbinabacrazyevenbringingsinagotnakitalalakeadadvdnaghuhumindigmahabangnagdalabusiness:vasquestumingaladisensyospareroboticsmagkakaroontrycycleganyankapwamarieelepantetumatawadtinitindapananakitpacebituinuniquespecialpangangatawansumuotbalatnapaghatianmalusogdurisummitpedekahoycompositoresnakakamitkasangkapanbeginningsfriendbestfriendmusicalfionakuninugalicuredtondomerrynuhcasessorrybunga1000sallybudokpowerpasoktoothbrushbook:paladbaldebulongkinalakihanmayorhalttinataluntongoodpinakabatangunanpaghihingalodibasiyang-siyasiyapasasalamatbluepamamalakadisinamapagepinapasayalilyhinahangaanmag-asawanagbiyayabacktinaasanmagnakawpaglalayagobservereranibersaryonamumuongnakatunghaynotnavigationniconakabuklatmaramingatinnaiiritangyesna-curioususohumalakhaksaymakapaibabawnakikini-kinitamagtatagalmakapangyarihannaglalatangoktubrebiologiioskonsultasyonhinawakannakaririmarimmakalipassalealbularyopamamasyalcultivarbuung-buobagnagmamadalidaramdaminpinasalamatanlarawancompletingnagtalagainaabutanculturetinutopnakatagokuwadernoentrancemagulayawsumusulatkalakitutungokumakainumuwipagkasabiambisyosangpinakidala