Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

4 sentences found for "musicales"

1. Desde la época medieval, se han practicado diferentes géneros musicales, como el canto gregoriano y el canto mozárabe

2. Durante el siglo XX, se desarrollaron diferentes corrientes musicales en España, como el Nuevo Cine Español y el flamenco

3. Muchas personas disfrutan tocando instrumentos musicales como hobby.

4. Otro festival importante es el Festival Internacional de Música y Danza de Granada, que se celebra en junio y presenta una amplia variedad de géneros musicales

Random Sentences

1. Scissors should be kept sharp to ensure clean and precise cuts.

2. Nag mungkahi naman ang Mayor na dapat unahin munang bigyan ng ayuda ang mga senior citizens.

3. Naglaba na ako kahapon.

4. Hindi ko alam kung paano ko malalampasan ang aking mga agam-agam tungkol sa aking trabaho.

5. Ang mga mamamayan ay nagpahayag ng kanilang mga mungkahi upang maresolba ang mga suliranin sa kanilang barangay.

6. Pumupunta ako sa Laguna tuwing Mayo.

7. Lazada offers a fulfillment service called Fulfillment by Lazada (FBL), which allows sellers to store their products in Lazada's warehouses and have Lazada handle shipping and customer service.

8. In conclusion, making a book is a creative and fulfilling process that requires planning, research, and hard work

9. I used my credit card to purchase the new laptop.

10. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

11. Hospitalization can increase the risk of developing infections, and patients may be isolated or placed in quarantine if necessary.

12. Ano-ano ang mga projects nila?

13. Los héroes nos inspiran a ser mejores y nos muestran el poder de la bondad y el sacrificio.

14. Mas mabuti pang magpakatotoo at huwag maging masyadong kababaw sa mga bagay.

15. Pinagpatuloy ko na ang pagkain ko.

16. Dahil sa maling pagdisiplina, naglipana ang mga pangit na gawi sa lipunan.

17. La lavanda es una hierba que se utiliza en aromaterapia debido a su efecto relajante.

18. Nagkakatipun-tipon ang mga ito.

19. Ang tubig-ulan ay maaaring magdulot ng kaguluhan sa mga lugar na hindi handa sa mga pagbabago sa panahon.

20. Hanggang ngayon, si Hidilyn Diaz ay patuloy na nagsasanay at sumusuporta sa mga atletang nangangarap tulad niya.

21. Elon Musk is a billionaire entrepreneur and business magnate.

22. The photographer captured the essence of the pretty lady in his portrait.

23. Los amigos que tenemos desde la infancia suelen ser los más cercanos y leales.

24. Protecting the environment requires a collective effort from individuals, organizations, and governments.

25. Les personnes âgées peuvent avoir des relations affectives et intimes avec leur partenaire.

26. Para cosechar la miel, los apicultores deben retirar los panales de la colmena.

27. The author was trying to keep their identity a secret, but someone let the cat out of the bag and revealed their real name.

28. Elektronisk udstyr kan hjælpe med at optimere produktionsprocesser og reducere omkostninger.

29. Ano ba problema mo? Bakit ba ayaw mong magpa-ospital?!

30. Elektronikken i en bil kan hjælpe med at forbedre kørsel og sikkerhed.

31. Kapag mayroong mga hindi inaasahang pangyayari sa buhay, madalas na nagkakaroon ng agam-agam sa mga tao.

32. She has a strong social media presence, boasting millions of followers on platforms like Instagram and Twitter.

33. Paano kayo makakakain nito ngayon?

34. Las hojas de lechuga son una buena opción para una ensalada fresca.

35. Nakatayo siya sa gilid ng bangin, waring nag-iisip nang malalim.

36. La creatividad nos permite pensar fuera de lo común y encontrar soluciones creativas a los desafíos que enfrentamos.

37. The internet, in particular, has had a profound impact on society, connecting people from all over the world and facilitating the sharing of information and ideas

38. They knew it was risky to trust a stranger with their secrets.

39. Ilan ang computer sa bahay mo?

40. La anaconda verde es una de las serpientes más grandes del mundo y es conocida por su capacidad para aplastar a sus presas.

41. Sa mga lugar na madalas tamaan ng buhawi, ang mga pamahalaan at mga organisasyon ay kailangang magkaroon ng mga programa para sa risk reduction at disaster preparedness.

42. Ang kanilang kaharian ay malapit sa isang maliit na gubat na kung saan ay malayang nakakapamasyal ang mayuming kagandahan.

43. Twitter allows users to send direct messages (DMs) to each other for private conversations.

44. Many people experience stress or burnout from overworking or job dissatisfaction.

45. Limiting alcohol and caffeine intake can improve overall health.

46. Dahil sa kanyang masamang ugali, siya ay isinumpa ng mangkukulam.

47. Para el Día de los Enamorados, mi pareja y yo nos fuimos de viaje a un lugar romántico.

48. Celles-ci comprennent la thérapie, le conseil et les groupes de soutien.

49. Sustainable transportation options, such as public transit and electric vehicles, can help reduce carbon emissions and air pollution.

50. Las hojas de las plantas de té deben secarse correctamente para obtener el mejor sabor.

Recent Searches

musicalesumulanipalinisprimerospinagkakaabalahanperwisyogumagamiteleksyonmarketing:apatgraphicmauntogpinipisilngunitnagsisihankubolangkayfearnagkitamatandaunangnagtawananmadurotanganfreelancerdespuesgagawinnitong1929carries1940coratinatawagminamahalmakulitipinatawag2001na-curiousmakabangonnaglabamagpahabailihimmagugustuhantuyotmahahaliktumaggapsabaykamaobuung-buojunjundali-dalingmataraynakataaslordsinalansankurakotku-kwentabuwayasapotkumakainmatesaalagangbellpawiinrewardingisinilangitinaobnag-iimbitamakukulayparehongrelobrindarnapuyatnoeliatflabaslugarreleasedsementocnicoactivityquarantineimportantebilhancongratsniyoautomatictingtumutuboyouthsumalakaymasungitpasensyabastonmaitimcandidateshinukayganunmagigitingpalapagnoonkriskanaglaonangalheartbreakcalidadfauxadoptedsupilinwashingtonexhaustedseniordiamondnicoramdamgreatsiemprefurganatherapybotesumakitdaanirogcornerstreatstechnologicalrisedingdingclassmateupworkthemhatingbaketendtipidnatinagnagpepekemiranewspapersmakauwinakahugnagbentaparusahansourcesalangannaglulusakbulaklaksuedenagpasensiyaantokahasbateryapasalamatanmag-aaralstomangingisdaaywankwebafacultyfansnatingalasasapetcarshagdanankasamatrainskarununganbatikasalukuyanpagsidlanhaymagbibiyahemagnakawnagpapaniwalanagsusulatnakapagreklamopagkakatuwaannakakitakikitaalbularyocultivapinakabatangpaglalaitculturalnagkasunogpagkabuhaymagkaparehopanghabambuhaymangangahoynamulaklakmakikikainyumabongnakaraankahariantraveltitanawawalahinimas-himas