Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Hindi ko kayang mabuhay ng mayroong agam-agam sa aking buhay.

2. I finally quit smoking after 30 years - better late than never.

3. Have you been to the new restaurant in town?

4. Emphasis can be used to express emotion and convey meaning.

5.

6. Ikinagagalak kong makilala ka, Maria.

7. Masarap higupin ang mainit na tsokolate sa malamig na gabi.

8. Kapag ang puno ay matanda na, sa bunga mo makikilala.

9. Hindi ko mapakali ang aking sarili dahil sa aking mga agam-agam tungkol sa aming kasal.

10. Maglalakad ako papunta sa mall.

11. Hindi dapat natin pahintulutan ang paglapastangan sa karapatan ng mga mahihina at marhinalisadong sektor ng lipunan.

12. Hinintay ko siya sa labas ng kanyang opisina upang sabay kaming kumain ng hapunan dahil gustong-gusto ko siyang ligawan.

13. Nagkantahan kami sa karaoke bar.

14. Bihira na siyang ngumiti.

15. The victim was relieved to finally have closure after the culprit behind the crime was caught and prosecuted.

16. Albert Einstein was a theoretical physicist who is widely regarded as one of the most influential scientists of the 20th century.

17. The United States is a culturally diverse country, with a mix of ethnicities, languages, and religions.

18. La realidad nos enseña lecciones importantes.

19. Another area of technological advancement that has had a major impact on society is transportation

20. Actions speak louder than words.

21. Microscopes have revolutionized the field of biology, enabling scientists to study the structure and function of living organisms at the cellular and molecular level.

22. I thought about going for a run, but it's raining cats and dogs outside, so I'll just stay inside and read instead.

23. Hindi ako sang-ayon sa pagdami ng mga krimen sa ating lipunan.

24. Limitations can be a source of motivation to push oneself to achieve more.

25.

26. May kakaibang naramdaman ang prinsesa sa makisig na binata na iyon.

27. Humihingal na rin siya, humahagok.

28. Nagbigayan kami ng mga regalo noong Pasko.

29. Advanced oscilloscopes offer mathematical functions, waveform analysis, and FFT (Fast Fourier Transform) capabilities.

30. Kapag dapit-hapon, masarap mag-relax sa veranda habang nanonood ng sunset.

31. Ang talambuhay ni Juan Ponce Enrile ay nagpapakita ng kanyang malawak na karanasan sa pulitika at pamumuno.

32. Sa gitna ng pagluluto, nagitla ako nang biglang mag-expire ang gasera.

33. Ang simbahan ay hitik sa mga deboto tuwing Linggo.

34. Tantangan hidup juga dapat mengajarkan kita tentang nilai-nilai seperti kesabaran, rasa syukur, dan ketekunan.

35. Oh, kinaiinisan mo pala? Eh bakit naging paborito mo?

36. Salbahe ang pusa niya kung minsan.

37. Napakalungkot ng balitang iyan.

38. Kepulauan Raja Ampat di Papua adalah salah satu tempat snorkeling dan diving terbaik di dunia.

39. El uso de drogas puede ser un síntoma de problemas subyacentes como depresión o ansiedad.

40. At isang araw nga, nagpasya sina Damaso at Magda na tumakas at mamuhay sa ibang lugar.

41. Nag-enjoy ako sa pag-aaral ng isang bagong wika kaya nahuhumaling ako sa pag-aaral ng iba pang wika.

42. Meron ho ba kayong mainit na kalamansi juice?

43. Gising ka pa?! parang nabigla nyang sabi.

44. Then you show your little light

45. Sana makatulong ang na-fund raise natin.

46. Binigyan sya ng dentista ng gamot matapos syang bunutan ng ngipin.

47. Estoy sudando mucho. (I'm sweating a lot.)

48. ¿En qué trabajas?

49. Balak kong magluto ng kare-kare.

50. Sa paglipas ng panahon, natutunan niyang tanggapin ang pag-iisa.

Recent Searches

asiatickatagalanherramientahigh-definitionmarangyangkamustainakyatjuanreviewfiverrlalongmadalingpamamahingahagdanfe-facebooktinapayhastadogssikoayokobusykasopriestiyanconsumelumulusobmasinopinagawnamnaminsusunodalexandermakaratingsuccessmininimizenagdarasalkasingtigashmmmmaniyahdtvfauxmadamisubalitpitobinawiprinceproductionduonpaskohousesanghojas,nilalangstrengthcommissionlargerzoompostcardscientificpakelambuwansaanfeedback,bosscomienzanpinag-usapaninterpretinglastingcomunessutiltwinklesedentaryeveningdendincontrolledwindowcuandostringflashshouldvanviewimprovedinternapaghahanguannag-googlematiyakmetodisktiningnanaddictionpapuntangnagtatakbodogcebunaririnignakaririmarimpagkakatayohighestjosepatutunguhancafeterialockdownsinundanglatekampeonramdamkaklasepicturesbagokapekailanpaguutosmarkedkasamaangbasketbolkisapmatakahusayanpakukuluaniiwasanevolucionadomagkanopaliparinanitaongomelettemayabongteknologikasingdeliciosananlakimanghikayatpresence,makapalagmakikikainflyvemaskinersaritanakatapatgagawinnapaiyakclubkagalakanpagluluksamakikipaglaronagtutulaknagmamaktolnagsisipag-uwianpagkalungkotnagbanggaankatagalforskel,sagasaannandayaumiinomkumidlatmagagawaexhaustionkamiasmagtigilencuestasmagbalikguitarralumakipacienciaumokayikatlongitinaobpantalonwriting,paglingonnakangisingbangkangcalidadkahaponbinatanag-ugatpatakbopagtatakananunuksonakabibingingsaan-saanmagpasalamatrenaianagpagupitmawalafollowedisinamaprotegidopananakitsunud-sunodcashtelevisionanubayananunginstitucionesmalasutlamagdilimpinaginiisipsalbahesila