Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Elektronisk udstyr kan hjælpe med at optimere produktionsprocesser og reducere omkostninger.

2. Ordnung ist das halbe Leben.

3. Limitations can be a source of motivation to push oneself to achieve more.

4. Nous avons opté pour une cérémonie de mariage intime.

5. Maaaring magbigay ng libro ang guro sa akin.

6. Musk has been at the forefront of developing electric cars and sustainable energy solutions.

7. La llegada de un nuevo miembro a la familia trae consigo amor y felicidad.

8. Nagtuturo kami sa Tokyo University.

9. Sweetness can also be found in natural sweeteners, such as honey and maple syrup.

10. Ang mailap na kapalaran ay kailangan tanggapin at harapin ng may lakas ng loob.

11. La agricultura sostenible busca minimizar el impacto ambiental del cultivo de alimentos.

12.

13. Dumating ang mga kamag-anak ni Fe.

14. La creatividad nos inspira y nos motiva a seguir adelante con nuestros proyectos.

15. Kebebasan beragama dijamin oleh konstitusi Indonesia dan dihormati dalam kehidupan sehari-hari.

16. Aling lapis ang pinakamahaba?

17. Kumaripas si Ana papunta sa terminal para hindi maiwan ng bus.

18. Mon fiancé et moi avons choisi nos alliances ensemble.

19. I finally quit smoking after 30 years - better late than never.

20. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

21. Masakit para sa isang ina ang sinapit ng kanyang anak ngunit masaya sa kaloobang tinanggap iyon ni Busyang.

22. The culprit who stole the purse was caught on camera and identified by the victim.

23. La perspectiva es una técnica importante para crear la ilusión de profundidad en la pintura.

24. The momentum of the train caused it to derail when it hit a curve too quickly.

25. Guilty. simpleng sabi niya saka ngumiti ng malapad.

26. The cake was a hit at the party, and everyone asked for the recipe.

27. Es importante no cosechar demasiado temprano, ya que las frutas aún pueden no estar maduras.

28. Hindi umano totoo ang mga balitang nag-resign na ang presidente ng kumpanya.

29. Ang paggamit ng droga ay maaaring magdulot ng pagkabaliw, paranoia, pagkabalisa, at pagkakaroon ng kawalan ng pag-iingat sa sarili.

30. He was one of the first musicians to popularize rock and roll, and his music and style helped to break down racial barriers and bring different cultures together

31. Magpupunta kami ng hospital mamaya upang magpa-checkup.

32. Alam na niya ang mga iyon.

33. Presidential elections are held in November and involve a system of electoral votes, where each state is allotted a certain number of votes based on population

34. Ang taong lulong sa droga ay parang nasasakal na kaluluwa na patuloy na hinahanap ang paraan para lumaya.

35. Mahirap kalabanin ang sakit na nagdadala ng agaw-buhay na pakikibaka.

36. He is also remembered for his incredible martial arts skills, his charismatic stage presence, and his dedication to personal development

37. Les personnes âgées peuvent être en bonne santé ou avoir des problèmes de santé.

38. Sino-sino ang mga nagsibili ng mga libro?

39. Good things come to those who wait.

40. May kinuha sya sa backpack nya, Dapat gumagamit ka nito.

41. Kebahagiaan adalah perjalanan pribadi yang unik bagi setiap individu, dan penting untuk menghormati dan mencari kebahagiaan yang paling sesuai dengan diri sendiri.

42. Basketball players are known for their athletic abilities and physical prowess, as well as their teamwork and sportsmanship.

43. Es importante elegir un powerbank de buena calidad para garantizar una carga segura y eficiente.

44. Nagsisilbi siya bilang librarian upang magbigay ng access sa kaalaman sa mga nagbabasa ng kanyang aklatan.

45. Ang mga guro ay humingi ng mga mungkahi mula sa kanilang mga mag-aaral upang mapabuti ang kanilang pagtuturo.

46. Pinagsama ko ang pulotgata at gata ng niyog upang gumawa ng matamis na meryenda.

47. Humahanga at lihim namang umiibig ang maraming kabinataan sa tatlong dalaga.

48. Bukas ang biyahe ko papuntang Manila.

49. AI algorithms are computer programs designed to simulate intelligent behavior.

50. Utak biya ang tawag sa mahina ang pag iisip

Recent Searches

high-definitionumaliskunehomagaling1973tumunogformasfakebringingorderinnatatakotbaroboyetsikmuraanimoyfaceredigeringokayoruganauliniganpamimilhingmasamacouldmabutingnuclearnasabidinihabilidadesbilernanlilimosfriesbiggestshouldkambingdecreaseamparocuandogreenmainstreamairplanessamutiposapatnapurhythmpromotingundasnakukulili1787healthierdesarrollarpag-indaksoundkagandahagbayaannagpapanggapmakakatakasgabingpadalasnagbakasyonlumakikansportsmarypicsinilistaimprovedimportantnasasabihannapapasayamagkasintahannagreklamonaglalaronakakatawasumugodmagbabakasyonadicionalesmakikitanagliliwanagtinitirhantagumpaynag-angatmakapaghilamosnahuhumalingnakatiraskypebuung-buopinabayaannanahimikexperiencesmonsignorbloggers,pagsumamoalbularyoseryosomagpaliwanagmaihaharapmahiwagavirksomhederkikitakapit-bahaynapapatungohila-agawanlisensyatravelerartistasguhitpagngitinagbiyayawalongpakakatandaanpeacematagpuannakasandigtinangkahintuturonagpabayadresortyourself,sikipnalakipinakidalatirangsanasnagtakakasintahanpioneerpagkasabidaramdaminkasiyahanroughkusinerofestivalesnaiilaganpagpapasakittiktok,mumuntingnabighanitinutopcancerpaghahanapnagpabotmagkaharapmakakakaennaabutanmasilippagtangonapasukotinamaanevolucionadonavigationtumamanakakaanimsinisiraautomatiskenglishnagbentaskyldes,umiibigpaidnasagutanhinihintaymagsugalprodujonaghihirapinuulcerkinumutangawainnapakagandanaiisipkumakainmagtigilistasyonpamasahenakasakitnami-missseguridadmahinamalulungkotmagalangmasasayapakanta-kantakagipitangumawanagkasakitmahinognaliwanagancrecermaghahabinanalonakalockalapaapipinatawagmismopuntahannanunuripagkagisingsenadoruulaminmasyadongmaanghang