Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Mahalagang magkaroon ng budget plan upang maiwasan ang pagkakaroon ng utang.

2. Players move the puck by skating, passing, or shooting it towards the opposing team's net.

3. Tengo una labradora negra llamada Luna que es muy juguetona.

4. Inalagaan ng mag-asawa ang halaman at nang lumaki ay nagkabunga.

5. Nasa Ilocos si Tess sa Disyembre.

6. Sa mga paaralan, kadalasang nagkakaroon ng mga proyektong pagtatanim ng mga punong-kahoy upang maituro sa mga mag-aaral ang kahalagahan ng kalikasan.

7. makaraan ang ilang sandali, dahan-dahan at nanlalambot siyang tumindig, nakatuon ang mga mata kay Ogor.

8. They were originally established in 1947 as the Minneapolis Lakers before relocating to Los Angeles in 1960.

9. The widespread use of digital devices has led to an increase in sedentary behavior and a decrease in physical activity

10. Electric cars can be charged using various methods, including home charging stations, public charging stations, and fast charging stations.

11. Einstein's most famous equation, E=mc², describes the relationship between energy and mass.

12. Napadungaw siya sa bintana upang tingnan ang magandang tanawin.

13. I have a tradition of taking a photo every year on my birthday to document how I've changed over time.

14. Nag-ugat sa puso ni Durian na mahalin ang sakop ng kanyang ama.

15. Nahuli ang magnanakaw ng mga sibilyan at iniharap ito sa mga pulis.

16. Isang araw, sa kanyang pagluluto hindi niya makita ang posporo.

17. Nakatingin siya sa nakasahod na balde ngunit ang naiisip niya'y ang bilin ng ina, na huwag na niyang papansinin si Ogor.

18. Nasa Diyos ang awa, nasa tao ang gawa.

19. Hindi ito maganda na maging sobrang takot sa lahat ng bagay dahil lamang sa agam-agam.

20. Ipaliwanag ang mga sumusunod na salita.

21. Palaging basahin ang alituntunin ng isang lugar.

22. At følge sin samvittighed kan være afgørende for at træffe de rigtige beslutninger i livet.

23. Nakiisa naman sa kanilang kagalakan ang mga kapitbahay.

24. Dapat lamang kayong maging kauri ng hayop, ang wika ng babaeng diwata pala ng ilog.

25. Durante las vacaciones, nos reunimos alrededor de la mesa para compartir historias y risas con la familia.

26. Natutunan ko ang mga awiting Bukas Palad mula sa aking mga magulang na parehong Katoliko.

27. Hindi ako komportable sa kanilang plano kaya ako ay tumututol.

28. Dahan-dahang naglayag palayo ang bangka mula sa pampang.

29. Det er vigtigt at være opmærksom på de mulige risici og udføre grundig forskning, før man beslutter sig for at deltage i gamblingaktiviteter.

30. Ang mga kawani ng gobyerno nagsisilbi sa publiko upang mapabuti ang serbisyo ng kanilang ahensiya.

31. Bilang paglilinaw, ang meeting ay hindi kanselado, kundi inilipat lang sa ibang petsa.

32. Napakaganda ng bansang Pilipinas.

33. I know things are difficult right now, but hang in there - it will get better.

34. Malamig sa Estados Unidos kung taglagas.

35. Bien que le jeu puisse être amusant et excitant, il est également important de se rappeler qu'il peut avoir des conséquences négatives s'il n'est pas géré de manière responsable.

36. Bago pa man napigilan ng bata ang babae ay naisubo na nito ang puting laman ng bunga.

37. Sige, tatawag na lang ako mamaya pag pauwi na ko..

38. To infinity and beyond! at binaba ko ulit yung telepono.

39. Eine gute Gewissensentscheidung kann uns helfen, unser Leben in eine positive Richtung zu lenken.

40. Ang pagkuha ng sapat na pahinga at tulog ay isang nakagagamot na paraan upang maibalik ang aking enerhiya at sigla.

41. Ang mga hanging taniman ng mga orchid ay gumagawa ng isang maganda at mayabong na tanawin.

42. Nagmamadali na ako ngunit dumaan pa sa gasolinahan ang driver ng dyip.

43. Les patients peuvent être autorisés à quitter l'hôpital une fois leur état de santé stabilisé.

44. Mon fiancé et moi avons choisi nos alliances ensemble.

45. Hindi mo alam ang kanyang tunay na nais dahil hindi mo alam ang kanyang kaibuturan.

46. When we forgive, we break the cycle of resentment and anger, creating space for love, compassion, and personal growth.

47. Eine klare Gewissensentscheidung kann uns helfen, uns selbst treu zu bleiben.

48. El proyecto produjo resultados exitosos gracias al esfuerzo del equipo.

49. Mayroon akong mga alinlangan sa kanilang plano kaya ako ay tumututol dito.

50. Malapit na ang halalan kaya't nagsulputan na naman ang mga samu't saring pagbati ng mga pulitiko.

Recent Searches

skypehigh-definitionmoodpaninigashabilidadesmananahiexistwebsitefindmuchresultaproudrawpoolpinagimprovedstudythoughtsnotebookgagawatalagangtomkalabanrestaurantfuturebestfriendproductsproduceiconsvidenskabenhitsurasocialbinigyanmaisipsulyapabasumunodschooldetallanhuertocommissioncredittheremangkukulamvirksomheder,villagede-dekorasyonmetoderaabsentmaninirahanmusmospoonbuslonakangisibestidomagtataasdescargardogsbibisitasangkalanmarahilpagtataposerlindakaramdamanmakitangpinagpalaluanpinakabatangkaawa-awangcanadaphonekinakaligligsinabimagdamanagermailapipinatawurihandaanhulingnagkatinginanmarasiganpanonoodprinsesadeliciosanakukuhasweetvideobinatilyobabesgabi-gabikuwartongbiglangjannasasaktannamamanghapiniligasolinakoreanpanatilihinhinimas-himasbetamagsisinealinmonumentofluiditymahusayahasvirksomhederbecomeyayabelievednaiinitanperpektingbinginamematalinoitinagohalamanworrynag-emailquetoysmasasamang-loobdiscipliner,rosarioiconhalu-halokutosino-sinonatitiratechniquesitinuturingkabinataannatuloynamumulatumambadcommunicationpunolalakadfull-timenamisssundhedspleje,milalitsonipinamiliconstitutionawakanginaemailanitungkolmatalikvanpasyenteliignagaganapmangahasposthimmikaelainiindaburmabinasaconsumebultu-bultongstaybumalikturonfederallilipadpakibigyannagkwentobagdalhandissetigilkadalagahanglastusongsalamatdamitagumpayhumahangoswidelyulanpinakamatunogpiyanoestilosantoniobukasaparadorbyesinapitkuwintaspahabolnaglaroiiwasanabalakusineropaumanhin