Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Nagka-cutting classes ako kanina dahil biglaang nagkasakit ako.

2. Hindi malaman kung saan nagsuot.

3. Kumain ako ng itlog kaninang umaga.

4. Dahil sa pagiging maramot, madalang siyang bisitahin ng kanyang mga kaibigan.

5. The Amazon Rainforest is a natural wonder, home to an incredible variety of plant and animal species.

6. Stress can be a contributing factor to high blood pressure and should be managed effectively.

7. They clean the house on weekends.

8. Ang mga bayani ay nagbibigay ng pag-asa at magandang kinabukasan para sa mga susunod na henerasyon ng mga Pilipino.

9. I don't like to make a big deal about my birthday.

10. Pwede ba akong pumunta sa banyo?

11. Tinuruan niya ang kanyang anak na maging magalang sa mga nakatatanda.

12. The website's social media buttons make it easy for users to share content on their social networks.

13. Ang monumento ni Mabini ay matatagpuan sa may lalawigan ng Batangas.

14. The chest x-ray showed signs of pneumonia in the left lung.

15. Wala kang dalang payong? Kung gayon, mababasa ka ng ulan.

16. Pinatawad din naman ni Ana ang mga ito.

17. Humihingal at nakangangang napapikit siya.

18. Nandito ang mga kaklase ni Raymond.

19. Umayos ka nga! Wala ka sa bahay!

20. The Great Wall of China is an impressive wonder of engineering and history.

21. No hay mal que por bien no venga. - Every cloud has a silver lining.

22. Les enfants commencent l'école maternelle à l'âge de 3 ans.

23. Kanino ka nagpagawa ng cake sa birthday mo?

24. Sa malamig ngunit maliwanag nang sikat ng araw, nakikita na niya ang langkay ng mga agwador.

25. Las hojas de papel se pueden reciclar para hacer papel nuevo.

26. Ang kasamaan ng anak ay kaya pa nilang pagtiisan ngunit ang paglalait at paghamak sa kanila bilang magulang ay hindi na niya mapalampas.

27. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

28. Pakibigay mo naman ang libro kay Anna para magamit niya sa kanyang takdang-aralin.

29. I heard that he's not trustworthy, so I take everything he says with a grain of salt.

30. Sa kabila ng mahigpit na bantay, nangahas silang tumakas mula sa kampo.

31. Sumaya ang mundo ni kuya dahil sa iyo.

32. Napakamot na lang ng ulo si Kenji.

33. People can also borrow money through loans, credit cards, and other forms of debt.

34. Napagalitan si Juan dahil na-suway siya sa paglabag sa traffic rules.

35. Pinadala na nya ang kanyang resignation letter sa pamamagitan ng email.

36. He's always the first one in the office because he believes in the early bird gets the worm.

37. Mahalaga ang pag-aaral sa talambuhay ni Teresa Magbanua upang maipakita ang papel ng kababaihan sa himagsikan.

38. Users can save posts they like or want to revisit later by using the bookmark feature on Instagram.

39. Lumabas lang saglit si Genna dahil may tumawag sa kanya.

40. La vaccination est un moyen efficace de prévenir les maladies infectieuses et protéger la santé publique.

41. The music playlist features a variety of genres, from pop to rock.

42. Påsketiden er en mulighed for at tilbringe tid sammen med familie og venner og nyde det forårsagtige vejr.

43. Pigain hanggang sa mawala ang pait

44. Money is a medium of exchange used to buy and sell goods and services.

45. Mahigpit namang ikinabit ng mga halaman ang mga ugat sa ilalim ng lupa.

46. He is watching a movie at home.

47. Tahimik na nanangis si Aling Rosa at laking pagsisisi dahil tumalab ang kanyang sinabi sa anak.

48. Ang pagkakaroon ng masayang pamilya ay siyang ikinagagalak ni Maria araw-araw.

49. Ang taong lulong sa droga ay parang nasasakal na kaluluwa na patuloy na hinahanap ang paraan para lumaya.

50. Hindi hadlang ang kahirapan sa pagiging bukas palad, ang kailangan mo lang ay malasakit sa kapwa.

Recent Searches

high-definitionnagtitiissubjectbinibiyayaanpagbatinaiwanginterests,pag-asakalalarokapainganidsiguromanakbofriendnagkalapitnanlilisiknalugodkayaabakahoynaliligopisaracompositoresadoptedmalayamansanasgrinsdollaryearelvispistaalapaapmeanguhitaparadornakaluhodtiyanniyoenglishenergimagkaibadatapwatfreelancernagtutulungannagtataasbecomingkasapirinpahabolasignaturalorenalacknalalabicynthiapwedengnunorganizemonumentosinungalingexperts,annikamagsimulalabahinkainananungninadancespeechcigaretteeyesulinganmulti-billionhardtabaspalayanpakakatandaankararatingi-rechargeexperttiktok,nakapasokpinag-aaralanmakikikainnagawangnapakagagandamiyerkolesmagsusunurantumulaknaglalakadnakabulagtangmakikitanagngangalangnakapagngangalitkategori,pagkuwabloggers,pagsalakayalikabukinmagkaparehonapatawagpinakamatabangnabalitaannakagalawhirampasasalamatdiferentescompaniesperpektingvidtstraktkuripottaga-ochandopagtatakaipinatawagreaksiyonmanahimiksistemaskongresomakabawipagtatanimmarurumimagpagupitmasasayalumuwasvehiclessuprememorenascottishcasahiningitapesaywalongrenaiaandreabook,pesosginoongbarcelonamatutongpesohinatidhinilayaritiniopalaybestalaalayatamaidinatakekuyabulakasiaticpayhumanotools,examsystematiskbroughtburgerbinibinimenospalapitbinatilyongprogrammingdevelopmentattackvanthingbeyondnamungahimigclientesfloorpeterbinabaancakewellheypasanimaginationritwalspecializedirogbilisumiilinglinawbagamacivilizationlapitanpakikipagbabaghinagud-hagodhinampasmagkitapaglisanmagselospaki-chargeipinabaliknakatigilsementongika-50