Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Pour maintenir sa motivation, il est important d'avoir des objectifs clairs et réalisables.

2. Nagtataka ako kung bakit hindi mo pa rin maipaliwanag sa akin kung ano ang totoong dahilan.

3. Dahil sa pagkahapo ay nahiga siya sa lilim ng punung-kahoy para magpahinga.

4. Las pinturas abstractas pueden ser interpretadas de diferentes maneras por el espectador.

5. Anung email address mo?

6. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

7. A successful marriage often requires open communication and mutual respect between a husband and wife.

8. Protecting the environment requires a collective effort from individuals, organizations, and governments.

9. Psss. napatignin ako kay Maico. Naka-smirk siya.

10. Nag-aalala ako dahil biglaan siyang umalis nang walang abiso.

11. Styrketræning kan hjælpe med at opbygge muskelmasse og øge stofskiftet.

12. The news might be biased, so take it with a grain of salt and do your own research.

13. I know I should have gone to the dentist sooner, but better late than never.

14. Der er mange forskellige rollemodeller og inspirationskilder for unge kvinder.

15. There were a lot of options on the menu, making it hard to decide what to order.

16. It’s risky to rely solely on one source of income.

17. Hindi mapigilan ang panaghoy ng binata nang mabasa ang liham ng kanyang mahal.

18. Noong 2019, nanalo si Carlos Yulo ng gintong medalya sa World Artistic Gymnastics Championships.

19. Ang mga bulaklak sa mesa ay nagbigay ng mabangong ambiance sa hapag-kainan.

20. Ang mga medical technologist nagsisilbi upang magbigay ng tumpak na resulta sa mga laboratory tests.

21. Biglaan ang pag-ulan kanina kaya ako ay nabasa nang husto.

22. Kucing di Indonesia adalah hewan yang sering menjadi teman dan sahabat bagi pemiliknya.

23. Lumabas na rin naman ako pagkatapos.

24. Sabi mo eh! Sige balik na ako dun.

25. Nakasuot siya ng pulang damit.

26. George Washington was the first president of the United States and served from 1789 to 1797.

27. Es importante mantener las heridas cubiertas y protegidas de la suciedad y los agentes irritantes.

28. Halos gawin na siyang prinsesa ng mga ito.

29. Hindi ko matatanggap ang kanilang panukala dahil mayroon akong mga reservations dito.

30. Work can also provide opportunities for personal and professional growth.

31. La decisión de la empresa produjo un gran impacto en la industria.

32. Revise and edit: After you have a complete draft, it's important to go back and revise your work

33. Sa tagal at hirap na dinanas ng binata sa paghahanap sa dalaga, nagalit siya.

34. Hindi siya makapaniwala kaya sinalat niya ang kanyang mukha.

35. They have been cleaning up the beach for a day.

36. Ang pagkakaroon ng malubhang karamdaman ay nagdulot ng malalim na lungkot sa aming pamilya.

37. She has lost 10 pounds.

38. Foreclosed properties can be a good option for those who are willing to put in the time and effort to find the right property.

39. The Great Pyramid of Giza is considered one of the Seven Wonders of the Ancient World.

40. The sun is setting in the sky.

41. Les préparatifs du mariage sont en cours.

42. Some people are allergic to pet dander and should take this into consideration before adopting a pet.

43. Selvstændige medarbejdere arbejder ofte på egen hånd.

44. Las labradoras son perros muy versátiles y pueden adaptarse a una variedad de situaciones.

45. Limitations can be frustrating and may cause feelings of disappointment and failure.

46. Gusto ko na talaga mamasyal sa Singapore.

47. Ang kuripot ng kanyang nanay.

48. Sa ikauunlad ng bayan, disiplina ang kailangan.

49. Hindi po ba banda roon ang simbahan?

50. The introduction of the dial telephone in the 1920s further improved the telephone system, as it allowed for faster and more efficient call connections

Recent Searches

high-definitionkinantanakamariapuedennatulogkatagalandalangpagpapasakithinugotsacrificeganidcarriesmarangyangnanayisinumpaganangarkilatag-ulanremainadversebigyansaytinitirhanalexanderlingidweddingmanuscriptmabilisorugasuffernagdaramdamomelettelamangfuehigitmegetsumamanyasabihingbernardobalingimportantesdasalkancreativekalapisingestasyontiyakmapakalijeromepwedephysicalplayedouetransparentspendingkarnabalroleeveninginalissutilbornsedentaryfinisheduminomplanemphasisinspiredkayacouldochandoredbakehalosbroadcastslearnandresimplengeveryhapasinrelievednag-isipumiinitformswindowcomputerspreadquicklycompletegitarawhetherlasingnagkalatmananahisilbinglikessinumanggripotitadumilimluluwasdinggraduationcomputersilognobodyporkasoybulakhamakbagnaghatidstyrerlahatsundalomadalastshirtsapatospagpapasanaguapasiyentekabuhayannamamakabaliktumatakboopgaversmallnananaghilisapattemparaturaumakyat3hrspesosngisisukatintiniobiggestreportyougoodeveninggandalagiproperlyfloornakakapasokpangangatawanmurang-murabateryamagtanghaliannagtungopaladmagsusunuranmagsunogevolucionadoseryosongtandangtsismosaumimiknakikilalangnabigaytaksipinagsaraosakanicofurtonightburgerschoolsirogcornersmalamigbotepuntaviewnapakalakikaninumanpagkaangatkinalilibingannakahugpilipinasbaliwumuwiseguridadnecesariotagaytaykawili-wilidistansyanagsusulatnakakatulongmakalaglag-pantysayawansteerpagkakalutomangangahoygayunmankinikitaressourcerne