Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Landet har en omfattende social sikkerhedsnet, der sikrer, at alle borgere har adgang til sundhedspleje, uddannelse og sociale ydelser

2. Siya ay kilala sa kanyang magalang na pag-uugali kahit sa mga hindi niya kakilala.

3. Pinahiram ko ang aking cellphone kay Alex habang inaayos ang kanyang unit.

4. Di Indonesia, bayi yang baru lahir biasanya diberi nama dengan penuh makna dan arti.

5. Ang bango ng kape sa umaga ay nagbibigay ng mabuting simula sa araw.

6. Amazon has been involved in the development of autonomous vehicles and drone delivery technology.

7. Ano ka ba Beast! Bumitaw ka nga, ang daming tao oh.

8. Lumuhod siya sa harap ng altar at tulala sa loob ng ilang minuto.

9. Isang bata ang lumapit sa magandang babae at nagbigay ng kapiranggot na makakain.

10. Tesla's goal is to accelerate the world's transition to sustainable energy and reduce reliance on fossil fuels.

11. Natayo ang bahay noong 1980.

12. Ayaw niyang kumampi sa matatalo kung kaya't ang ginawa niya ay nagmasid-masid muna ito sa di kalayuan at pinanood ang nagaganap na labanan.

13. Amazon's customer service is known for being responsive and helpful.

14. Scientific evidence has revealed the harmful effects of smoking on health.

15. Oscilloscopes can capture and store waveforms for further analysis and comparison.

16. Oo, malapit na ako.

17. Ang mga construction worker nagsisilbi upang magtayo ng mga gusali at imprastraktura.

18. Some fruits, such as strawberries and pineapples, are naturally sweet.

19. Es un cultivo versátil que se puede utilizar para hacer alimento para humanos y animales, y también se utiliza en la producción de biocombustibles

20. Ang haba na nang bigote mo, mag ahit ka nga!

21. Madali naman siyang natuto.

22. Ang tugtugin ay may mababa ngunit malalim na tono.

23. Hindi siya makapagtaas ng mabibigat dahil mababa ang kanyang timbang.

24. Ang hirap maging bobo.

25. Las hojas de palma se usan a menudo para hacer sombreros y cestas.

26. Ang aking ina ay isang magaling na mananahi.

27. Bawal magpapakalat ng mga fake news dahil ito ay nagdudulot ng kaguluhan at kawalan ng tiwala sa media.

28. Gumagalaw-galaw ang sabog na labi ni Ogor.

29. Mahirap mahalin ang isang taong mailap at hindi nagpapakita ng tunay na damdamin.

30. Gusto kong matutong tumugtog ng gitara.

31. Negative self-talk and self-blame can make feelings of frustration worse.

32. Pagod na ako at nagugutom siya.

33. Nang malapit nang magdilim, kumaripas na ang mga magsasaka pauwi sa kanilang tahanan.

34. Gumising ka na. Mataas na ang araw.

35. Ang pag-inom ng tsaa tuwing umaga ay isa nang ritwal na nagbibigay ng enerhiya sa kanya.

36. Ang lakas mo uminom wala ka naman ambag.

37. Hindi ko alam kung saan ito mag-uumpisa, pero may gusto ako sa iyo.

38. Aray! nagcurve ball sya sa sakit sa sahig.

39. Estoy muy agradecido por tu amistad.

40. Muchas personas utilizan las redes sociales para expresar sus opiniones y puntos de vista.

41. It has revolutionized the way we communicate and has played a crucial role in shaping modern society

42. Mahigit sa pitong libo ang isla sa Pilipinas.

43. Nakikita si Carlos Yulo bilang inspirasyon ng maraming kabataang Filipino.

44. Ang hangin sa takipsilim ay malamig at presko.

45. Women have been subject to violence and abuse, including domestic violence and sexual assault.

46. "Hindi lahat ng kumikinang ay ginto," ani ng matandang pantas.

47. Hindi naman natuwa ang mga estudyante sa pagkakaroon ng reshuffling dahil kailangan nilang lumipat ng silid-aralan at mag-adjust ulit sa kanilang mga kaklase.

48. Sa loob ng maraming taon, pinaunlad niya ang kanyang abilidad sa pagsasalita ng iba't ibang wika.

49. Investing refers to the process of allocating resources with the expectation of generating a profit.

50. Hindi nawawala ang halaga ng panitikan sa pagpapalaganap ng kultura at kaalaman, kaya't ito ay mahalaga sa buhay ng mga tao.

Recent Searches

legacyhigh-definitionpshbatobecomesubalitomelettehidingcenterayonredigeringlingidlindoltungkolnakakarinigelectsatisfactioncoinbaseexperiencesiconprospertomarconvertidassumindisumasambalatestcesabsnarooneksaytedkarnabalclassroomscheduleeveningdiniwhethertopiceitherinterviewingevenonlydosbaketelevisedgamotenterhudyatmulakantoanjocondonapakatalinodilimpaghahabibalangreadersnagtatanongkumembut-kembotbinabamostabangandulotsakalingmakulitsumimangottemperaturapagsusulatnagngangalangpagnanasaumiiyakbrasolunasnawalanmoneymalamangtarangkahannapakabaitsampaguitagovernmentgayundinparingngusomemberstelebisyonna-curiouspinabayaanbangamayabangtipidininommalasutlatobacconilapitanmagkitakanilamaghandadefinitivomommyshockikatlonggenerosityatentopreskomatustusanbinuksanpatakbongnasiyahanpusongambagnasugatanbihiramadamotmurachavitsamakatuwidnawalabatangmataastextogitnarelonaglalatangheretabimag-anakangkingtaonhahaiyonroonkulotnangyaripapelsinasadyasanatanongeventsmagagalingeksenasiyamnapadungawlabingsharknaibibigaysundaloedukasyonkuwadernolangitsamakatwidfacilitatingpagkabatacelulareshalikmagkababatamakikipaglarothirdmisusedmatagalphysicalbiyahetuktokwishingkasingtigasheyhehedasalmaisiptonmagtipidchartsgayunpamanmaaliwalascapablenagkakilalamakikiraannanggigimalmalmakinangmakakawawapuwedemaglalakadahasnatinnaglalambingtalagangkahaponmagingyeheygumapangnagitlapaskomahirappalibhasakawayannagsulputandumaanguhitmaunawaanstaymaliligobunga