Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Umalis siya upang hanapin ang sandok na hinahanap.

2. Ariana has won numerous awards, including two Grammy Awards, multiple Billboard Music Awards, and MTV Video Music Awards.

3. El arte callejero es una forma popular de arte urbano.

4. Les étudiants peuvent poursuivre des études supérieures après l'obtention de leur diplôme.

5. Le marché boursier peut être un moyen de faire fructifier son argent.

6. Ang kuripot mo naman, minsan lang ako magpalibre eh.

7.

8. It's raining cats and dogs

9. Mayroon akong ibang mungkahi at ito ay ang dahilan kung bakit ako tumututol sa kanilang panukala.

10. If you are self-publishing, you will need to choose a platform to sell your book, such as Amazon Kindle Direct Publishing or Barnes & Noble Press

11. Sa isang forum ng mga mamimili, ibinahagi nila ang kanilang mga mungkahi upang mapabuti ang kalidad ng mga produkto.

12. Elektronik kan hjælpe med at forbedre adgangen til information og vidensdeling.

13. The artist painted a series of landscapes inspired by her travels.

14. Pinangaralang mabuti ng ina si Kiko na huwag uulitin ang ginawang paglapastangan nito sa punso dahil masamang magalit ang mga lamang-lupa.

15. Parating na rin yun. Bayaan mo siya may susi naman yun eh.

16. Les sciences de la Terre étudient la composition et les processus de la Terre.

17. Sa pagguhit, puwede ka rin mag-experiment ng iba't-ibang kulay at matutunan ang mga color combinations.

18. The invention of the motion picture camera and the development of television and video games have provided new forms of entertainment for people of all ages

19. Hindi ka niya kayang lokohin dahil alam niya ang kaibuturan ng iyong mga motibo.

20. She has been running a marathon every year for a decade.

21. Lagi na lang lasing si tatay.

22. Ano ho ang gusto ninyong orderin?

23. The eggs are beaten until the yolks and whites are well combined.

24. He is watching a movie at home.

25. Users can follow other accounts to see their tweets in their timeline.

26. I know I should have started studying earlier, but better late than never, right?

27. I forgot your birthday, but here's a card anyway. Better late than never, right?

28. Ang tunay na kayamanan ay ang pamilya.

29. Kahit na maliit ang kanyang bahay, basta't nagmamahalan ang mga tao, sapat na iyon.

30. It has brought many benefits, such as improved communication, transportation, and medicine, but it has also raised concerns about its effects on society

31. The stock market can provide opportunities for diversifying investment portfolios.

32. Trump's administration faced scrutiny and investigations, including the impeachment process in 2019 and 2021.

33. Nangyari ang isang insidente na nagdulot ng takot sa kanya, kaya't nais niyang maglimot na lang tungkol sa pangyayaring iyon.

34. Love na love kita palagi.

35. The bakery specializes in creating custom-designed cakes for special occasions.

36. Los sueños pueden ser grandes o pequeños, lo importante es tenerlos y trabajar para hacerlos realidad. (Dreams can be big or small, what's important is to have them and work towards making them a reality.)

37. Con permiso ¿Puedo pasar?

38. Pakibigay sa tindera ang tamang bayad para hindi siya malugi.

39. Ano ang gusto mong panghimagas?

40. Ako si Rodona ang diwata ng budok na ito.

41. Bawal mag-abuso ng kapangyarihan dahil ito ay isang krimen.

42. Natakot ang batang higante.

43. The information might be outdated, so take it with a grain of salt and check for more recent sources.

44. Additionally, television has also been used as a tool for educational programming, such as Sesame Street, which has helped to teach young children reading, writing, and math

45. While the advanced countries in America and Europe have the wealth and scientific know-how to produce solar and nuclear energy on a commercial scale, the poorer Asiatic countries like India, Pakistan, and Bangladesh may develop an energy source by bio-gas-developing machines

46. Walang humpay ang pagdudugo ng sugat ng tigre kaya agad agad itong kumaripas ng takbo palayo sa kweba.

47. "Huwag kang susuko," ani ng coach sa kanyang koponan bago magsimula ang laro.

48. Palayo nang palayo ang barko habang papalubog ang araw.

49. Ang paglalakad sa tabing-dagat tuwing umaga ay nagbibigay sa akin ng isang matiwasay na karanasan.

50. Masaya akong napanood ko na live ang pagkanta ng Bukas Palad sa isang fundraising event.

Recent Searches

inalagaankatagalanhigh-definitionpangyayarikasoyawitinmaariparinasthmaalexanderbinatangflaviobinasanochefakecafeteriamadamiroomorugalingidgivelapitangrinsarbejderdahilorasankapilingprogramsexampleklasecontrolapataytakotbinawinagniningningnatatanawbalitarestawrankasalukuyanpaglisantanongkuwadernokitanamumuongmarumingmukadagatpartiessiyabilihinkubyertosatinlamanhalalandireksyonmakikiligoskills,anikabutihantemperaturaclosefederaltradisyonipinanganakvelfungerendetuwingloansso-calledlupainisinakripisyokalayuantiktok,makaraannagtatampogriponakahigangkapangyarihannagpaalammakawalasamakatuwideyenakasahodpamilyangaktibistanavigationpaostumigilfysik,marahilbabatayopulakaliwainiirognanonoodperpektingmuntikangawaingkalabanvitaminnaantighumihinginakaluhodsinungalingsabogtanawaregladonatayoallemaestrapresencenangbinibilanghetomaliitelenaathenahinagpisweredipangmagisingpakilutokablanattentioncanadacalciumrumaragasangdoktorsilayyeloritobarnesnagreplyumiilingpicsdemocraticnakakamanghamacadamialinemalabodancespaghettispeedbulsamakaangalna-curiouspanigbukodestablishedcareechavenariningnatatawanguminomkakaibabahagingasulpagkaingnadamatransportmidlerilaninvesting:gitaraspreadcompletetutorialsexistneedsmagandakinamumuhianmaibabalikvariedadsilyaayonkulangadditionally,yeytawagnapakamisteryosonagsisipag-uwianininommarketplacesikinamataypresidentialtinatawagkaloobangmakahiramsinadalagaartificialflyvemaskinerpinahalatamakatarunganglondonmabatongumigtadsulatnakatagodoble-karaminamahal