Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Oscilloscopes can be portable handheld devices or benchtop instruments with larger displays and advanced features.

2. Environmental protection can also have economic benefits, such as creating jobs in sustainable industries.

3. Medarbejdere kan arbejde i forskellige miljøer som kontorer eller fabrikker.

4. Jouer de manière responsable et contrôler ses habitudes de jeu est crucial pour éviter des conséquences graves.

5. The lightweight design of the tent made it easy to set up and take down during camping trips.

6. I'm not going to pay extra for a brand name when generic options are a dime a dozen.

7. Dapat bigyan ng karampatang atensyon ang mga isyu ng sektor ng anak-pawis.

8. Cryptocurrency has the potential to disrupt traditional financial systems and empower individuals.

9. Ang mga sumusunod na salita ang nagsasabing siya ay pulubi.

10. Dun na nga raw pala tayo dumeretso sabi ni Tita Andrea.

11. Puwede ba akong sumakay ng dyipni?

12. Kumaripas si Lito nang makita niyang naglalakad na papalapit ang guro niya.

13. Ang pagtanggap ng mga bisita at pagkakaroon ng masayang kasiyahan ay bahagi ng mga tradisyonal na okasyon sa Chinese New Year.

14. Palibhasa ay may kakayahang magpahayag ng kanyang mga kaisipan nang malinaw at mabisa.

15. "Dogs come into our lives to teach us about love and loyalty."

16. Users can like, react, or share posts on Facebook to show their engagement and support.

17. The cake was so light and fluffy; it practically melted in my mouth.

18. The pretty lady in the park was surrounded by admirers.

19. She is cooking dinner for us.

20. Bigla nya akong hinigit sa kwelyo, Anong sinabi mo?

21. Nagkakamali tayo sapagkat tayo ay tao lamang.

22. LeBron James continues to inspire and influence future generations of athletes with his remarkable skills, leadership, and commitment to making a difference both on and off the court.

23. It's hard to enjoy a horror movie once you've learned how they make the special effects - ignorance is bliss when it comes to movie magic.

24. Huwag kang pumasok sa klase!

25. La tecnología agrícola ha mejorado la eficiencia y la calidad de la producción de los agricultores.

26. Maria, si Ginang Cruz. Guro ko siya.

27. Maraming uri ng mga punong-kahoy na maaaring gamitin sa paggawa ng mga gamit tulad ng upuan, mesa, at iba pa.

28. Pagkababa, mabilis na siyang nagyayang umuwi.

29. Makisuyo po!

30. Sa bawat pagkakataon na nabibigo ako, naglalabas ako ng malalim na himutok upang maibsan ang aking kalungkutan.

31. Nagbigay ng malaking tulong sa akin ang aking guro sa paghahanda sa aking thesis.

32. The executive branch, represented by the President of the United States, is responsible for enforcing laws

33. Has he finished his homework?

34. Mag-aaral ako ngayon, datapwat sa hapon ay pupunta ako sa doktor.

35. En invierno, se pueden ver hermosos paisajes cubiertos de nieve y montañas nevadas.

36. Le travail est une partie importante de la vie adulte.

37. Hiramin ko ang iyong bike para sumali sa cycling event sa Sabado.

38. Pahiram ng iyong sasakyan, wala akong ibang masasakyan pauwi.

39. Ang pagtugtog ng malamig na musika ay nakatulong sa akin na magrelaks at magkaroon ng matiwasay na isip.

40. I like how the website has a blog section where users can read about various topics.

41. Napakagandang dalaga, wika niya sa sarili at tuloy-tuloy na nilapitan niya ito.

42. Saan ka kumuha ng ipinamili mo niyan, Nanay?

43. Napakagaling nyang mag drowing.

44. The Watts Towers, a collection of unique and intricate sculptures, are a testament to the city's artistic expression.

45. The player who has the ball is called the "offensive player," and the player guarding him is called the "defensive player."

46. The telephone has also had an impact on entertainment

47. Ang pag-asa ay nagbibigay ng pagkakaisa sa mga tao sa kanilang pangarap at mga layunin sa buhay.

48. Nagkakaroon ng pagdiriwang sa Batangas tuwing ika-23 ng Hulyo sa pag-alala kay Apolinario Mabini.

49. The acquired assets will be a valuable addition to the company's portfolio.

50. If you're looking for the key to the office, you're barking up the wrong tree - it's in the drawer.

Recent Searches

marmainghigh-definitionjenadiyosmeronsundaefarmnatalongpitumpongbandaarguesignbingoopobumabahachoihmmmtupeloartistskinsetalentoutlinepagkalitonagtalagamadamifiaiskoreboundbio-gas-developingusobuslosinkinomsemillastsedagalabortonmasdanbriefbobokamatisgamotasulsuffercompostelapolopasyaadditionbokipagamottools,starspecialsumasambamisusedbridebarthroughoutsedentaryneronotdaangmuchoscomplicatedcadenairogavailabledatapwatconnectionordertrainingimagingalinobstaclestipidipinahalikaideaipapainitpasswordmenuanotherpersistent,countlessfeedbackcircleenvironmentestablishedeveryreadingsafebowenglandhinabiandroidmessagedoesaffectmediumpacegapadaptabilityinfinitylargepasinghalpinagmamalakinaglakadothersinasikasosay,sasakyanmagandatahimikbangkauntingtubigrevolutioneretrolandlangyaumupomauntogprobinsyadiseaseltodamitkapeendabsnapakatagalnagkitamakakatakasagricultoresdadalawinmagagandangmaghahatidkatuwaanmakuhangleksiyontantanankalayaanmangahasgumawamakikitulogibinilikapwapumulotsanggolangelapinaulanangatolcoalhuwebesproducts:maibalikhouseawakatedraloperahanpopulationadddragoncollectionstodopaki-bukashulingbroadcastsbabaikinatatakotgubatnamuhayinatupagpinangyarihanmaglarotinakasanpaaralansasapakinkenjisumuwaybiglaiiklimayumingboracayramonubodminutoanimbrucepanghihiyangmarchantmalasutlaprodujolightinterviewingexitutilizanmagpa-ospitalmagpagalingpaghihingalosiksikan