Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Nais ko sanang sabihin sa iyo na may gusto ako sa iyo nang mas maaga pa.

2. Pumunta sila sa albularyo upang magpagamot ng kanyang pananakit ng likod.

3. I admire my mother for her selflessness and dedication to our family.

4. Hindi rin niya inaabutan ang dalaga sa palasyo sa tuwing dadalawin niya ito.

5. May email address ka ba?

6. Napakabango ng sampaguita.

7. Det er vigtigt at tage hensyn til ens egne begrænsninger og sundhedstilstand, når man vælger en form for motion.

8. I played an April Fool's prank on my roommate by hiding her phone - she was so relieved when she found it that she didn't even get mad.

9. She started a TikTok account to showcase her art and gain more exposure.

10. En af de vigtigste drivkræfter i den danske økonomi er eksporten

11. Ang kanyang pagkanta ay animo'y pumapasok sa puso ng mga nakikinig.

12. Magandang umaga po, mga mahal na manonood.

13. Scientific analysis has revealed that some species are at risk of extinction due to human activity.

14. Pinapagulong ko sa asukal ang kamias.

15. Makisuyo po!

16. Los héroes son personas valientes y audaces que se destacan por su coraje y determinación.

17. Lazada has a strong focus on customer service and has won awards for its efforts.

18. Nous allons nous marier à l'église.

19. Ang sarap maligo sa dagat!

20. La foto en Instagram está llamando la atención de muchos seguidores.

21. Sa panahon ng pandemya, maraming tao ang naging nag-iisa dahil sa lockdown.

22. Nakikisalo siya sa pamilya at totoong nasisiyahan siya.

23. Despite his untimely death, his legacy continues to live on through his films, books, and teachings

24. Puwede ba bumili ng tiket dito?

25. Matapos ang isang mahirap na araw, nagpalabas ako ng malalim na himutok para maibsan ang aking pagod.

26. In 1977, at the age of 42, Presley died of a heart attack

27. A balanced and healthy diet can help prevent chronic diseases.

28. Namangha si Nicolas sa kanyang narinig sapagkat unang beses lang siyang nakarinig ng dalagang natutuwa sa mga palaka.

29. Isang makisig na binata na halos kaedad din ng magandang prinsesa.

30. We have completed the project on time.

31. The bag of groceries was too hefty for the elderly woman to carry on her own.

32. Nag-aalala ako para sa kalusugan ko, datapwat hindi pa ako handa para sa check-up.

33. Sa pamamagitan ng isip ay pinaglagablab ni Tarcila ang barko ng mga pirata.

34. Different types of work require different skills, education, and training.

35. Ang bayanihan ay nagpapalakas ng samahan at pagkakaisa sa aming pamayanan.

36. Pakisabi kay Melissa, binabati ko siya.

37. Kucing di Indonesia juga sering dibawa ke salon kucing untuk melakukan perawatan bulu dan kesehatan mereka.

38. Ang tula na isinulat niya ay ukol kay Romeo na matalik niyang kaibigan.

39. Naglalaba siya ng mga kumot at kurtina upang mapanatili ang kalinisan ng aming tahanan.

40. Ayaw ko magtangkang magbiyahe nang walang mapa.

41. Ang mainit na tasa ng tsokolate ay animo'y nagbibigay init sa malamig na gabi.

42. The store offers a store credit for returns instead of a cash refund.

43. Ipinagbibili ko na ang aking kotse.

44. Hintayin mo ko.. Kahit anong mangyari hintayin mo ko..

45. Sino ang kasamang kumanta ni Katie?

46. Noong una, sinasagot niya ang mga panunuksong ito.

47. Les impôts sont une source importante de revenus pour l'État.

48. Ano ho ang tingin niyo sa condo na ito?

49. Sa Manila Hotel ka titigil, hindi ba?

50. He listens to music while jogging.

Recent Searches

indiajenasakithigh-definitionnahihilobecamekindsinihandaitemsmenosipaliwanagtonightsinapakfianeed,palagimorenamrssinagotmahahabalockedmundoanotomarthanksgivinghydelmurangsystematiskexamsumusuno1980ipagamotbobocryptocurrency:pinagsulatedwinphilosopherkumarimoteveninginuminbaleumiinithanpyestabagganda18thnag-aralmulti-billioncleanimagingfigureclientesdayclassroomharmfulkasinggandaplatformsbigmotionsambitcharitablecountlessberkeleyaffectgeneratedhateapollocomputereprotestachooseboracaymagkasamangbinasaayudaanak-mahirapmasaktanpagbigyanpinalakinggarbansospulisvedhinipan-hipandadkasamaanniyaeksamenochandopebrerosakimbabeskumpunihinmemorialscientistpoliticsmauupokakaininkangneroartistatutusinforeverpakilagayhomenabubuhaynagpapakainhumigit-kumulangbalitaewansocietypossibleyoutube,malasutladilawmindanaorailwaysnalulungkotanakcapitalistlinggo-linggonasarapanpagkaingbateryakailanganpagngitikundimanmagitingsiembrabopolshumbletrycyclehinogarbejderkitpollutionbusyangtainganandooncommissionoliviamatchinghigitverylegendsmarioinantoksinipangimportantesdevelopedallowsnaibabapronounsofahapunansiguradofysik,mahuhulipinalalayasuniversitynanangispaoskapintasangpabulongnasaankinauupuanhumalakhakinspirasyonpagpasensyahannalalabinakakagalananlilisiknagkwentonagtitindadistansyamagpa-picturecultivomakalaglag-pantykayang-kayangnakaliliyongdumaankaagawmustlumahokpagkagustomagkaibangnagpabotpinamalagihitahumahangosmapagkatiwalaansakristanlumikhahayaangkanlurannakahainlumilipadmaasahandaramdaminpambahaymawawala