Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Facebook Marketplace is a platform where users can buy and sell items locally.

2. An omelette is a dish made from beaten eggs cooked in a pan.

3. Some ailments are preventable through vaccinations, such as measles or polio.

4. Es importante trabajar juntos para abordar la pobreza y promover un mundo más justo y equitativo.

5. La physique est une branche importante de la science.

6. Las redes sociales pueden ser un lugar para descubrir nuevos productos y tendencias.

7. Ang banal na kumbento ang naging tahanan ng mga sakristan.

8. Pardon me, but I don't think we've been introduced. May I know your name?

9. Sa kabila ng mahigpit na bantay, nangahas silang tumakas mula sa kampo.

10. El amor todo lo puede.

11. Nahantad ang mukha ni Ogor.

12. Anong ginagawa mo? nagtatakang tanong ko.

13. They have adopted a dog.

14. Ilang termino na syang nagsisilbi bilang mayor ng kanilang lungsod.

15. Nag re-review si Gina para sa darating na board exam.

16. Ang punong-kahoy ay isa sa mga kinakatigan ng mga environmentalist sa pangangalaga ng kalikasan.

17. Ang bayanihan ay nagbibigay inspirasyon sa aming mga kabataan na maging aktibo at maging bahagi ng komunidad.

18. Kailangan mo rin ng malalim at malusog na lupa na may sapat na konsentrasyon ng nutrients

19. May luha nang nakapamintana sa kanyang mga mata at ang uhog at laway ay sabay na umaagos sa kanyang liig.

20. Agad naman na ngpunta si Aling Edna sa bahay nila na daladala ang parte nila sa napaghatian na gulay at bigas.

21. He thought he was getting a free vacation, but I reminded him that there's no such thing as a free lunch.

22. Ang mga anak-pawis ay nangangailangan ng patas na pagkakataon upang magkamit ng tagumpay at umangat sa buhay.

23. Its cultivation on a wide scale with the help of negro-slaves made it one of the major export items in the American economy

24. Nagbabakasyon ako sa beach kasama ang pamilya kaya masayang-masaya ako ngayon.

25. Bata pa lamang ay kinakitaan ng ito ng husay sa larong chess.

26. Una niyang binasa ang batok---kaylamig at kaysarap ng tubig sa kanyang batok.

27. Sa ganang iyo, dapat bang palakasin pa ang kampanya laban sa fake news?

28. Hinde na ko nag dalawang isip pang lapitan sila.

29. Después de varias semanas de trabajo, finalmente pudimos cosechar todo el maíz del campo.

30. Musk has been described as a visionary and a disruptor in the business world.

31. Ang talambuhay ni Andres Bonifacio ay nagpapakita ng kanyang matatag na pagtitiis sa gitna ng mga pagsubok.

32. Hindi ko inakalang siya ang nangahas na maglagay ng graffiti sa pader ng paaralan.

33. The novel's hefty themes of love, loss, and redemption resonated with readers around the world.

34. Patients may be discharged from the hospital once their condition has improved, or they may need to be transferred to another healthcare facility for further treatment.

35. Ang pagpapalinis ng ngipin ay mahalaga para maiwasan ang mga sakit sa bibig.

36. Bagaimana cara mengirimkan email? (How to send an email?)

37. Bilang ganting langit sa mga kabutihan nina Waldo at Busyang, sila ay pinagkalooban ng isang anak na pagkaganda-ganda.

38. Kahit hindi ka magaling sa pagguhit, puwede ka pa ring matuto at mag-improve sa pagguhit.

39. Nang marating niya ang gripo ay tungo ang ulong tinungo niya ang hulihan ng pila.

40. Nous avons opté pour une cérémonie de mariage intime.

41. Magdidisko kami sa makalawa ng gabi.

42. La lluvia produjo un aumento en el caudal del río que inundó la ciudad.

43. Naglipana ang mga bulaklak sa hardin dahil sa maayos na pag-aalaga.

44. Las hojas de té son muy saludables y contienen antioxidantes.

45. Los Angeles, California, is the largest city on the West Coast of the United States.

46. Actions speak louder than words.

47. Me siento caliente. (I feel hot.)

48. Pumupunta ako sa Laguna tuwing Mayo.

49. "Huwag kang matakot, kaya natin ito," ani ng sundalo sa kanyang kasamahan.

50. En tung samvittighed kan være en kilde til stor stress og angst.

Recent Searches

high-definitionkuloteducationpangilcarriesmalapitanwriteprogramscuandogeneratedpublishedrepresentativehastamakisignakasahodpusonakilaladinihinugotmatangkadbirthdayfriendbagalyoungadventstreamingculturamundonangyarimunalanapagkahapomarsonaapektuhankinalilibingannapilingtanggalincurrentpahirame-explainlot,allemejodailytillsolarnapadaanpuedeskinukuhakabosessenatemuliproveexpeditedgreatlyanubayannapilitangtilianilakamalayankaniyanagawangdrinkssiguroritomind:paratinglikelybakeputiresponsiblechamberscementedeksenaautomationbalotincidencenetflixdeterminasyonchickenpoxiniisipmatipunoiiwanpagsidlanendvidereumulannatitirangmasungitmaasimnaghubadprotegidohanap-buhaymakidaloeskuwelanapaiyakkinabubuhaynakalipaskarwahengnagpatuloyclubnananaghililumalangoytinulak-tulakvirksomheder,congressbeyondseryosogagamitrewardingafternoonmanakbomatumaltelecomunicacioneslandetgagandakinalakihantumalonmagtigilkinumutankalabawmagbibigayforskel,ganitopapayaminatamisstaymaghihintayhistorykagubatanpeksmanisinagotganunengkantadalinakasiyahangmandirigmangsahigunosnanigaskaninahapdidatapwatagilitydisappointdyanreloatentopopcornpinyahumalikmangingisdahmmmanywheremaaaribumabagmakahingiaksidentekulayibalikdrayberpinapakiramdamanencompassespinggan1787husokwebamaaripariresortgiveandroidcertainguidesmalldumaramiskillbadingfacepagnanasapananglawpanlolokomakilalalumibotiniinomthinksamahananitiyakancuredbayankakayanangsangamag-isamag-inamadulasmadamotmadalasmabagalmababawmaaring