Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Hindi niya namalayan na tatlong oras na siyang tulala sa harap ng kanyang computer.

2. Madalas itong nag ku-kwenta ng kanyang mga kinikita.

3. Sa mga nagdaang taon, yumabong ang mga proyekto para sa kalikasan at kabuhayan ng mga tao.

4. Ang buhay ay isang mumunting paraiso lamang.

5. Pasensya ka na anak, ang lahat ng ginagawa namin ng iyong ama ay para sa iyo.

6. Inalagaan niyang mabuti hanggang sa ito'y magbunga.

7. Ang takip-silim ay isang magandang panahon upang magpahinga at magrelax mula sa mga pagod ng araw.

8. Ang boksing ay isa mga sa sports na kinahuhumalingan ng mga Pilipino.

9. Kahit saan man ako magpunta, hindi ko makakalimutan ang aking kaulayaw.

10. Ani niya, wala nang makakatalo sa kanyang kakayanan.

11. This can include creating a cover, designing the interior layout, and converting your manuscript into a digital format

12. Mahalagang mag-ingat sa ating kalusugan, datapapwat ay hindi natin nakikita ang mga mikrobyo at virus na nagdadala ng sakit.

13. Ilang kilo ng pinya ang binili niya?

14. At tuluyang nagliwanag ang buong paligid at nawala ang dalawa.

15. Ayaw mo ba akong kasabay? maya-maya eh tanong ni Anthony.

16. Marahil ay maaga kang dapat umalis upang makarating sa pupuntahan mo sa oras.

17. Kailangan mo ng matapang na puso upang lumaban sa agaw-buhay na mundo ng negosyo.

18. Sa Chinese New Year, ang mga tao ay nagbabasbasan at nagpapalakas ng kanilang mga panalangin para sa magandang kapalaran.

19. Tumingin ako sa direksyon kung saan sya nagtatrabaho...

20. El estudiante con el peinado raro está llamando la atención de sus compañeros.

21. Nagdala siya ng isang bigkis ng kahoy.

22. Tila hindi pa tapos ang laban, kaya’t kailangan pa nating maghanda.

23. Ang pagpapalit-palit ng oras ng pagtulog ay maaaring makapanira sa sleep cycle ng isang tao.

24. En invierno, los animales suelen hibernar para protegerse del clima frío.

25. Inflation kann auch die Sparquote verringern, da das Geld weniger wert wird.

26. Cancer is a complex disease, and ongoing research and collaboration are essential for developing new treatments and improving patient outcomes

27. Ang guro ang nagsusulat sa pisara upang maipaliwanag ang leksyon.

28. The project gained momentum after the team received funding.

29. They are often served with a side of toast, hash browns, or fresh greens.

30. Napatingin ako sa menu. Parang nagc-crave ako sa hotdog.

31. Si Doming na nagkaroon ng kasintahan na maganda ay inagaw ng kanyang kaibigan

32. Tak ada gading yang tak retak.

33. Bilang paglilinaw, wala akong sinabing tataasan ang singil, kundi magkakaroon lang ng kaunting pagbabago sa presyo.

34. He does not argue with his colleagues.

35. Ang pagkuha ng sapat na pahinga at tulog ay isang nakagagamot na paraan upang maibalik ang aking enerhiya at sigla.

36. She was worried about the possibility of developing pneumonia after being exposed to someone with the infection.

37. Los niños a menudo disfrutan creando arte como una actividad educativa y divertida.

38. Higupin natin ang gatas habang mainit pa.

39. Ang mga pangarap natin ay nagbibigay sa atin ng inspirasyon upang magtrabaho nang husto.

40. They have planted a vegetable garden.

41. Les écoles offrent des programmes d'apprentissage des langues pour les étudiants.

42. They play a crucial role in democratic systems, representing the interests and concerns of the people they serve.

43. Ito ay alay nila bilang pasasalamat kay Bathala.

44. Sumakay ako ng taxi sa hatinggabi upang umuwi.

45. Los héroes son reconocidos y celebrados por su valentía y altruismo.

46. Ang mga punong-kahoy ay kadalasang tinatanim bilang mga pampaganda sa mga pampublikong lugar tulad ng parke o plaza.

47. Ailments can have physical symptoms, such as pain, fatigue, or fever, as well as psychological symptoms, such as anxiety or depression.

48. Environmental protection is not a choice, but a responsibility that we all share to protect our planet and future generations.

49. Maganda ang mga alaala ko dito sa Pilipinas.

50. Malapit na ang pyesta sa amin.

Recent Searches

high-definitionawitanpoorerpinggansabishineshundrednapagodpalakasagutinusuariotahimikmarasigansilasomecornerclientespreviouslyyonginugunitanagbakasyonnagtatrabahonakakitahampaslupagayunmanpagtangispinakamagalingnapakabaitibinentanagpaalamikinalulungkotnakuhangbiologipinapasayananahimikkagipitannagmistulangpaanongyoutube,hopemakakabalikbyggetvillagenapapahintovedvarendegelaie-booksnaaksidentemagbayadpakibigyansakalingsiopaobalikatgabikumainmensbasketballkundimanpaatiemposfavorniyoglikodnabiglatagalmaestraherramientasanimcorrectingpaglapastanganpahiramkaawayedadpaladlumiwagadoptednagdaosbulongmahigitcurtainsnagpasannahulaanbisikletamarietawadisposaltalentroselleyourself,need,tarcilaseniorkumukulorevolutionizedkantodiagnosticbitiwannasabingmedidaparangngunitpalamutimenossilbingrailwayslossburmaiyancigarettespagegisinglutokahirapanputahepedeabstainingspecializedintroduceeksamitimmulti-billionballtuluy-tuloyfuturemulingstyrergawinkaninathirdconvertingexistinagawsusunodpagsasalitamasinopsyncsameprocesotapemakabawimagulayawpasaherovictoriapaglalayagfascinatinglugawartistassigloupangnatulalapagsalakayogorpaidnapahintobinuksanhinatidpagongmagsimulanapasigawrabeyarimayamanlumulusobwalongwesleynaroonduribilerspendingmapagodpanguloexplainmakapangyarihangpatuloyjosenagbiyayakahonnakitasingaporejantaongmayabongmarkedpootnakakapagpatibaypinapakinggankahusayanlegislationmagpagalingpagkababalamangubobulaklakmanuscriptkakaininorasgalitrosekusinasina