Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Los amigos que tenemos desde la infancia suelen ser los más cercanos y leales.

2. Ang abilidad na mag-isip nang malikhain ay nagbibigay daan sa paglutas ng mga problema.

3. Maaf, saya tidak mengerti. - Sorry, I don't understand.

4. Anong gamot ang inireseta ng doktor?

5. Sa aming pagdiriwang ng buwan ng wika, nagkaroon kami ng pagtatanghal na nagpapakita ng kahalagahan ng bayanihan.

6. Nationalism often emphasizes the importance of a common language, culture, and history.

7. Hindi ko na kayang itago ito - may gusto ako sa iyo.

8. Ariana is an advocate for animal rights and follows a vegan lifestyle.

9. Anong kulay ang gusto ni Elena?

10. Nakapag-simula ako ng halinghing exercise nang hindi inaasahan na makakatulong ito sa aking anxiety.

11. Los héroes defienden la justicia y luchan por los derechos de los demás.

12. Nasa unibersidad si Clara araw-araw.

13. Los cuerpos de agua ofrecen un hábitat para una gran diversidad de especies acuáticas.

14. Teka anong ginagawa niyo dito? 9 na ha!

15. The children are not playing outside.

16. Wag mo nga akong lokohin. Sige na.

17. Jacky! Pare! nakangiti niyang sabi habang papalapit kami.

18. "Tapos na ang laban, wala nang dapat pang pag-awayan," ani ng punong barangay.

19. Pigain hanggang sa mawala ang pait

20. Il est important de savoir gérer son argent pour éviter les problèmes financiers.

21. Actions speak louder than words.

22. May mga kultura na gumagamit ng mga tradisyunal na hudyat sa mga seremonya o ritwal upang iparating ang mga espesyal na kahulugan.

23. One April Fool's, my sister convinced me that our parents were selling our family home - I was so upset until she finally revealed the truth.

24. They are not cleaning their house this week.

25. Hay muchos riesgos asociados con el uso de las redes sociales, como el acoso cibernético.

26. Limitations can be a result of societal or systemic inequalities and discrimination.

27. La conciencia es la voz interior que nos guía hacia lo correcto y lo incorrecto.

28. Gusto kong malaman mo na may gusto ako sa iyo kahit na hindi ko ito masabi sa iyo nang personal.

29. She admires her mentor's leadership skills and work ethic.

30. Ang ganda naman ng bago mong cellphone.

31. La visualisation et la réflexion sur ses réussites passées peuvent également aider à maintenir la motivation.

32. Malapit na ang pyesta sa amin.

33.

34. Kung ako sa kanya, niligawan na kita

35. Ayaw niya ng mga maarteng bagay kaya hindi siya mahilig sa mga mamahaling gamit.

36. Ang kanilang anak ay tinawag nilang Amba.

37. Ikinagagalak naming ipahayag na nagkaroon ng positibong pagbabago sa ating komunidad.

38. We need to calm down and not let this become a storm in a teacup.

39. Sa kaibuturan ng aking puso, alam kong tama ang aking ginagawa.

40. Bagaimana cara memasak nasi yang enak? (What is the recipe for cooking delicious rice?)

41. Marami nang nakapaligid sa kanila, mga batang nagtitinda, lalaki at babaing mamimili.

42. Iniintay ka ata nila.

43. Sayang, jangan lupa untuk makan malam nanti. (Dear, don't forget to have dinner tonight.)

44. Walang matimtimang birhen sa matiyagang manalangin.

45. Maramot ang bata sa laruan kaya walang gustong makipaglaro sa kanya.

46. Las hierbas frescas añaden un toque de color y sabor a las ensaladas.

47. Madalas na mayroong agam-agam sa mga relasyon at pag-ibig ng mga tao.

48. Parang kaming nageespadahan dito gamit ang walis at dustpan.

49. Bumalik ako sa dakong huli para iwan ang aking cellphone na naiwan ko sa table.

50. Facebook Messenger is a standalone messaging app that allows users to have private conversations with friends and contacts.

Recent Searches

manakbohigh-definitionsinakopsumpainkadalagahangbagongbulalasnakaratingtvsnakagagamotlalargatinaposnagbiyahekumalmaattentionmagisingsumigawnatayomadriddekorasyoncommercialtherapynailigtaspicspapapuntakinaumagahanhahahaaktibistanoongnakahigangcanadakindlewondereksamleadingfederalphilippinepakakasalannasiyahananyokumaenyelomagsalitakapepulang-pulatanyagunti-untitog,sikipminamadalisequegenerabaglobemarielpangilasignaturarepublicanculturemaestraturonkinagatgayundinsiopaonagpaalamkasingexistcardigannakasahodallekaninanayoniikutansiksikanmarahilnahigahumihingiipinamiliconvey,pag-ibigupuanpayapangstarnagtataemagkahawakjolibeetarcilaapelyidopiercontentnagdarasalaidpaskopanginoonhalagabigassenadordi-kawasaaguapermitelandodisyembrehiwagakatibayangmag-anaklockdownpinakamasayabringvaccinestumatawamagdaandawadventpanatagrosamensahepagkaimpaktopanghimagasnasulyapanpigilansagotlaganapobserverersocialstaplenagpasannuevosnakakapagtakabalingbaultaga-hiroshimasedentarysilbingigigiitikinamatayrelypaghaharutanwalongsulyapitaksyanglumakasredigeringuncheckedumikotumigiblorenaguestscenterchildrennapatawagninanangyayarigratificante,streetbangkomakitababasahinnasagutanpamanhikanmamanhikaninuulcermagkaibahastamaipagmamalakingmasasalubongmisyuneronakakadalawmarangyangpinamalaginahulikangkongsaan-saanpaki-bukaspasancynthiasumasayawmalamangpaglalabapinanawanbarung-barongdumilatmaunawaannagbabalabagalhiningikassingulangvissinabimakikipagbabagtrafficunidosfavorkaibigannaroonsegundosasayawinhatingalaalasinghalabala