Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. The Serengeti National Park in Tanzania is a natural wonder renowned for its wildlife and annual migration.

2. Nakatingala siya kay Ogor, mahigpit na kinukuyom ang mga palad.

3. Sinubukan niyang salatin ang pader sa dilim upang makahanap ng pinto.

4. Kung walang panget, walang pagbabasehan ng ganda niyo!

5. En helt kan være enhver, der hjælper andre og gør en positiv forskel.

6. Nakasama umano sa listahan ng mga apektado ang ilang barangay sa lungsod.

7. Taksi ang sasakyan ko papuntang airport.

8. Es importante cosechar las zanahorias antes de que se pongan demasiado grandes.

9. Wala ka naman sa kabilang kwarto eh.

10. Mamaya na lang ako iigib uli.

11. The waveform displayed on an oscilloscope can provide valuable information about signal amplitude, frequency, and distortion.

12. The political campaign gained momentum after a successful rally.

13. Hindi ka puwedeng pumasok sa unibersidad.

14. The value of money can fluctuate over time due to factors such as inflation and changes in supply and demand.

15. Ang mga miyembro ng komunidad ay hinikayat na magbigay ng kanilang mga mungkahi upang mapabuti ang mga serbisyo ng pamahalaan.

16. Ang pangamba ay maaaring maging dahilan ng pagkakaroon ng insomnia o hindi makatulog sa gabi.

17. pagkaraan ng kargang iyon ay uuwi na siya.

18. Hinahabol ko ang aking hiningang mahina dahil sa kalagitnaan ng marathon.

19. Hindi umabot sa deadline ang kanyang report, samakatuwid, binawasan ang kanyang grado.

20. Binilhan ko ng kuwintas ang nanay ko.

21. I can't believe how hard it's raining outside - it's really raining cats and dogs!

22. Eh? Anlabo? Hindi mo naman kaboses yun eh.

23. Basketball can be a fun and engaging sport for players of all ages and skill levels, providing an excellent opportunity to develop physical fitness and social skills.

24. Sleeping Beauty is a princess cursed to sleep for a hundred years until true love's kiss awakens her.

25. Maaliwalas ang simoy ng hangin sa probinsya.

26. Balita ko, maraming restawran sa Boracay.

27. Ang pagkakahuli sa salarin ay nagdulot ng kaluwagan sa mga biktima at kanilang pamilya.

28. Matitigas at maliliit na buto.

29. Mahiwaga ang espada ni Flavio.

30. El nacimiento de un bebé es un recordatorio de la belleza de la vida.

31. Hindi niya agad napansin ang sugat hanggang sa sinubukan niyang salatin ito.

32. Love na love kita palagi.

33. Tinatawag niya ang anak ngunit walang sumasagot.

34. Ang pangamba ay kadalasang sanhi ng hindi pagpapakatotoo sa mga tao sa paligid natin.

35. Naisip nilang tinangka ng kanilang anak na sunugin ang kanilang bahay.

36. Matapos ang isang matinding pagsubok, hindi maiwasan ang paglabas ng malalim na himutok.

37. Después del nacimiento, el bebé será evaluado para asegurarse de que está sano y para determinar su peso y tamaño.

38. A father is a male parent in a family.

39. Raja Ampat di Papua Barat adalah tempat wisata yang indah dengan banyak pulau-pulau kecil, terumbu karang, dan satwa liar.

40. Hindi dapat natin kalimutan ang kabutihang loob sa mga taong nangangailangan, samakatuwid.

41. Buhay ay di ganyan.

42. Binasa niya ang balikat, ang mga bisig.

43. Las hierbas de provenza son una mezcla de distintas hierbas secas, ideales para condimentar platos.

44. Det er vigtigt at have en kompetent og erfaren jordemoder eller læge til stede under fødslen.

45. Ngunit may isang hayop ang hindi niya malaman kung saan siya papanig.

46. The little boy was happy playing in his sandbox, unaware of the problems of the world - ignorance is bliss when you're that age.

47. Indonesia adalah negara dengan keragaman agama yang besar, termasuk Islam, Kristen, Hindu, Buddha, dan lain-lain.

48. Ibinigay niya ang bulaklak sa nanay.

49. Hindi maganda na maging sobrang negatibo sa buhay dahil sa agam-agam.

50. Algunas obras de arte son consideradas obras maestras y son muy valoradas.

Recent Searches

vetohigh-definitionasiatickasaysayanwaterthankhotelbestidamayamangtinikmournednakapuntaparkingtabihanarguelaybrari1950sumaagos1954coaladditionallyleftgruposeriouspiecesiloilosnobhojasgabingdietalexanderhmmmmsipadipangnitongfridayipanlinisfakepakainbalingbarnessellorugamalapadmay-bahaylangmalaboprobablementebinabaanmatangpasokpasyacoachingwelllatelarrypinakamalapitrightmuchoslabananresponsibleoffermanueleveningbridelinehardfull-timepinatirauseefficientdatabasahatesamethoughtsapppotentialprotestaimprovedkasingsimpelkalamansimusicalesputaheeducationalnamumulaklakminervieskillskagayachavitnasasakupanresourcesryanhinandenpahirammagamottumigilfysik,paosnagsamasiguradofactorespamagatumiyaktinahaksponsorships,nanghihinamadpinagtagpomakikitaeskwelahanerhvervslivetpatutunguhanmonsignornagmungkahimakakatakasnaglalakadrenombrenagpapaigibhila-agawannapakahabatalagapagkabuhayopgaver,pagkalitoenergy-coaltreatsbusinessesmahiwaganaulinigancultivarpagtatanongmasungititinatapatlalabasnakatitigpawiinkulunganpalasyosalbahengngumingisikongresoinaaminmagbigaysparkasiapapalapitculturesgawaingproducehagdananpapayainiirogbintanaginawangnatanongcoughinglovemoodvampires1973maliniscuentanfurybasahancebufireworksrestawanumabotmasayamusicunangriegaincredibleisinamanagsimulafollowedgalaansayaumagadustpanexpeditedilagaynapakanuevobunutanaguaannikaninadiyosnasansurroundingspsssmarmaingmatigaskontingkapainmalikottuloyaddiction