Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

38 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

21. Stress can be a contributing factor to high blood pressure and should be managed effectively.

22. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

23. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

24. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

25. The doctor measured his blood pressure and diagnosed him with high blood pressure.

26. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

27. The king's court is the official gathering place for his advisors and high-ranking officials.

28. The laptop's hefty price tag reflected its powerful specifications and high-end features.

29. The medication helped to lower her high blood pressure and prevent complications.

30. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

31. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

32. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

33. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

34. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

35. The patient's family history of high blood pressure increased his risk of developing the condition.

36. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

37. Up above the world so high

38. Up above the world so high,

Random Sentences

1. Ngumiti lang siya saken bilang sagot.

2. Ang pag-uusap namin ng aking kasintahan ay nagpawi ng aming hindi pagkakaunawaan at nagbigay-daan sa pagkakasunduan.

3. Napuyat na ako kakaantay sa yo.

4. Maraming aklat ang naisulat tungkol kay Apolinario Mabini at ang kanyang kontribusyon sa kasaysayan ng Pilipinas.

5. La pobreza es un problema que afecta a millones de personas en todo el mundo.

6. Ani Karing ay naiinggit ito kay Bereti dahil nakukuha ang lahat ng gusto.

7. Nakasuot siya ng damit na pambahay.

8. Durante el invierno, es importante tener un buen sistema de calefacción en el hogar para mantenerse caliente.

9. Indonesia adalah negara dengan keragaman agama yang besar, termasuk Islam, Kristen, Hindu, Buddha, dan lain-lain.

10. Umiinom si Andy ng vitamins kaya ang katawan nito ay bihirang magkasakit.

11. Pour maintenir sa motivation, il est important d'avoir des objectifs clairs et réalisables.

12. Pakiramdam ko ngayon ay puno ng inis dahil sa ginawa mo.

13. Algunas obras de arte son consideradas obras maestras y son muy valoradas.

14. Selamat ulang tahun! - Happy birthday!

15. Makikitulog ka ulit? tanong ko.

16. En verano, nos encanta hacer barbacoas en el patio durante las vacaciones.

17. Lumingon ang bata sa kanyang paligid, inisa-isa ang mga mukhang nakatunghay sa kanya

18. The internet is full of April Fool's hoaxes and pranks - some are funny, but others are just mean-spirited.

19. Nasa harap ako ng istasyon ng tren.

20. Some fruits, such as strawberries and pineapples, are naturally sweet.

21. Sa loob ng paaralan, ang ingay ng mga mag-aaral ay binulabog ang kasiyahan ng mga guro.

22. Il est important d'avoir une compréhension des probabilités et des cotes lorsque l'on joue.

23. Sa mga lugar na mayroong tag-ulan, kadalasang tumataas ang presyo ng mga prutas at gulay dahil sa hirap sa pag-ani.

24. Kapag nalulong ka na sa droga, mahirap nang makalaya sa hawla nito.

25. Ngumiti siya at lumapit kay Maico.

26. Kulay pula ang libro ni Juan.

27. Hindi lahat ng ating mga pangarap ay madaling makamit, kaya't kailangan nating magpakatatag.

28. Ang bansa ay dapat lagi nating isipin, hindi lamang ang ating sariling interes.

29. I've been using this new software, and so far so good.

30. Ngunit ang bata ay naging mayabang.

31. Sa karagatan ay masusumpungan ang magagandang koral at mga isda.

32. The professional athlete signed a hefty contract with the team.

33. Ang bagal ng internet sa India.

34. Dumating ang pangulo sa pagtitipon.

35. Isulat mo ang pangalan mo sa papel.

36. Na-suway ang batang lalaki nang hindi umuwi sa oras na itinakda ng kanyang magulang.

37. Nasabi ng binata na ang bunga ay katulad ng matandang madamot na dating nakatira sa lugar na iyon.

38. Quiero expresar mi gratitud por tu paciencia y comprensión.

39. Les employeurs cherchent souvent des travailleurs expérimentés.

40. Pinaayos ng paaralan ang ilaw sa silid-aralan upang hindi na magkakaroon ng problema sa lighting.

41. Naramdaman ko ang kanyang halinghing sa aking tainga dahil sa sobrang lalim ng kanyang paghinga.

42. La santé sexuelle est également un élément important de la santé globale d'une personne.

43. Trump's administration faced scrutiny and investigations, including the impeachment process in 2019 and 2021.

44. Mahalaga na magpakatotoo ka sa mga taong bukas palad sa iyo upang mas maintindihan ka nila ng husto.

45. Mabini Hall ang tawag sa gusali kung saan nagsisimula ang mga klase sa Polytechnic University of the Philippines.

46. Samantala sa malayong lugar, nagmamasid siya ng mga bituin sa kalangitan.

47. Yep, basta lang ibibigay mo sakin ang araw mo ngayon.

48. Bumili ako ng prutas sa Berkeley Bowl.

49. They are often served with a side of toast, hash browns, or fresh greens.

50. Lazada's mobile app is popular among customers, with over 70 million downloads.

Recent Searches

high-definitionnginingisihanhanap-buhaynakataposnakakapagpatibaysilabinawisementosamahanwikakaswapangannahantadmagpapakabaitpinakamatunogcommunicategreatlyemocionesleksiyonfireworkspananglawpaboritonggumuglongkailannakaratingtesskainanpagpapaalaalarawsalelutuinbalingpaksaonenagpasensiyamakapagpahingalegislationpaulatandaaksidentepasosapatiphonenakaririmarimnangangaloglackvivacareercuandobagkuswalakidlatkaninhulubagyopresidentialkontinentengsoonproduktivitetbakaalwaysmagbabakasyondentistaputinganimales,expandedenfermedades,primerasginamagigingpinabilibihasamakatayomere1000papasabuwisnasaangmesadondekaagawsiempremaipapamanamadalasautomatiserestudiedakmaoperahanambagooglestyresoninternetlanaroboticsformwalkie-talkiepasensyamarketplacesresortpauwinagniningnings-sorrynamumulaklaklimospinaglagablabnagtataepagtangissaansaritanatagalanbaboybroadcasttaga-ochandomahabaadditionmakapangyarihangbinibiyayaannagrereklamonangapatdanprogramamaghaponinteragerertuwasikmurakumunotconstantlyschedulehopecesmagkasabaycoraanitonogensindedatanawawalanapatingalatradisyonbumisitacubiclerolandmerrythinkpagkataobuwayapagtutolbaulnagsusulputanentrytelefonerkaniyangnandunnanunuksonakaakmapagbubuhatansupilinkababayanpagtiisanturismoparehonghuwagkumpletokaalamandingginkasohudyatnanaoglinggongsimbahanmalayaitinaasnababakasatensyonangkandagatbinitiwanglobetawamagtatampoobra-maestratagumpaysamakatwidna-fundconvey,nanaypumapasokpulisguerreropackagingmatulunginnangagsipagkantahanindustrysomemichaelanimtekstnaririnigimaginationhanapinmasterbumili