Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Dahil ang alam lang ay kumain, hindi alam ni Ranay kung paano ma-buhay na siya ang kikilos at magta-trabaho.

2. Dahil sa magandang kwento, hindi ko namalayang nahuhumaling na pala ako sa pagbabasa ng nobela.

3. Bawal magpakalat ng mga hate speech dahil ito ay nakakasira ng kalagayan ng mga taong napapalooban nito.

4. Bakit ba? Hinde ba ko pwedeng magsungit?

5. Higit kong daramdamin kung ako na itong nagawan ng di mabuti ay sa kanya pa manggagaling ang huling salita.

6. Ang matandang babae ay pinagpalaluan ng buong barangay dahil sa kanyang karunungan at malasakit.

7. Napakabagal ng proseso ng pagbabayad ng buwis, animoy lakad pagong.

8. Sa aling bahagi ng pelikula ka natawa?

9. "Huwag kang matakot, kaya natin ito," ani ng sundalo sa kanyang kasamahan.

10. Kailangan nating magkaroon ng lakas ng loob upang tuparin ang ating mga pangarap.

11. Bagama't nawalan ng kapangyarihan ay naging maligaya naman ito sa piling ni Ramon at ng kanilang mga anak.

12. Sa itaas ng burol, tanaw na tanaw ng lahat na nagdudumaling lumabas si Kablan sa tindahan.

13. Sa tulong ng mga batang nagsilapit, ang matanda ay nakatindig.

14. Hindi dapat natin ipagkait sa mga kabataan ang agaw-buhay na pagkakataon sa edukasyon.

15. Binigyan sya ng dentista ng gamot matapos syang bunutan ng ngipin.

16. The United States is the third-largest country in the world by land area and the third most populous country in the world.

17. En god samvittighed kan være en kilde til personlig styrke og selvtillid.

18. Sa panahon ng digmaan, madalas masira ang imprastraktura at mga kabuhayan ng mga tao.

19. Hendes øjne er som to diamanter. (Her eyes are like two diamonds.)

20. To infinity and beyond! at binaba ko ulit yung telepono.

21. Kebahagiaan adalah hasil dari kepuasan, keseimbangan, dan rasa bersyukur atas apa yang kita miliki.

22. Les travailleurs peuvent être affectés à différents horaires de travail, comme le travail de nuit.

23. Un powerbank completamente cargado puede ser una fuente de energía de respaldo en caso de emergencia.

24. Lazada has a strong focus on customer service and has won awards for its efforts.

25. Ang taong lulong sa droga ay parang nasasakal na kaluluwa na patuloy na hinahanap ang paraan para lumaya.

26. Kareem Abdul-Jabbar holds the record for the most points scored in NBA history.

27. Nag-iyakan ang dalawang batang sina Maria at Jose.

28. "Bawal magtapon ng basura rito," ani ng bantay sa parke.

29. Ang kanyang mga galaw ay tila naglalayo ng loob ng iba, palayo sa kanya.

30. Mi mejor amigo siempre está ahí para mí en los buenos y malos momentos.

31. Amazon's customer service is known for being responsive and helpful.

32. Dala ng malakas na pagdidilim, mas lalong nahirapan akong makita ang daan pabalik sa tahanan.

33. Ang mga Pinoy ay likas na masipag at maabilidad sa anumang trabaho.

34. Pagkain ko katapat ng pera mo.

35. Anong bago?

36. The momentum of the athlete propelled him across the finish line.

37. Hockey coaches develop game plans and strategies to help their team succeed.

38. Facebook has billions of active users worldwide, making it one of the largest social media platforms.

39. Umuwi na tayo satin.. naramdaman ko ang pagtango niya

40. Sayang, kamu tahu betapa bahagianya aku bersama kamu. (Darling, you know how happy I am with you.)

41. Maarte siya sa pagpili ng kanyang mga kaibigan kaya hindi siya basta-basta nakikipag-usap sa mga tao.

42. May mga turista na nagpasyang lumibot sa pamamagitan ng bisikleta para mas mapadali ang kanilang paglalakbay.

43. Aalis na ko mamaya papuntang korea.

44. Les élèves doivent travailler dur pour obtenir de bonnes notes.

45. Users can like, comment, and share posts on Instagram, fostering engagement and interaction.

46. They offer rewards and cashback programs for using their credit card.

47.

48. Lebih baik mencegah daripada mengobati.

49. La conciencia puede hacernos sentir culpables cuando hacemos algo que sabemos que está mal.

50. Sepandai-pandainya tupai melompat, akhirnya jatuh juga.

Recent Searches

high-definitionnagbabababiocombustiblesalexanderfonoscelularesresumenindiatanodtsakalumulusobpaki-drawingmaismaulitgenemalisanmapagkalingakalangumawagawaingmagka-babyrestlumipassabadongadvancementwordsnagtatanonghverkasaysayankalalarosenatepalancabasahinpagbabagong-anyobangbinibiyayaankukuhapwedebobopinagsanglaanadverselymillionswaysfigureslavemiyerkulespagsisisialikabukinkapiranggotmaglutotaga-ochandodissekapepalamutipabiliperfectmakatarunganghabitestadosganaimprovengisifittuwangtopic,palaginghusaynitonasirapinagawapananghaliannananalongtarangkahannag-iimbitanaiilagannakadapapagmamanehoantonio1954surveysnagpasamaisasamasiopaosiyudadbilibidsamantalangorkidyastapepinansincanteenlungsodpaninigascualquiermakaiponlumutangkaninogayundinpalipat-lipatpagbisitadaladalasupilinaumentarbinasayatainterestsnagpuntaeclipxeitaasmakakalimutinnapakomakakabalikinagawnapapansinpilipinasvillagetagaytaypambatanghalu-haloiniisipparehasbilanggobumuhosprobinsyaanubayankaraniwangarabiaclubpagtiisanpulang-pulanamulatmagkakagustokumbinsihinikinakagalittelevisioncriticsoliviahydelcontestsumusunoumingitbroadcastshowswellitinulosnilayuanmatangumpaylandasmaestraprotegidonauntogumuposhiningltobecameuntimelynahihiloanihinself-publishing,kindskatapatlordomgnumerosasorderinsalarinbaronakapuntaarbejdertitigilexistvisualroughbinilingclocksambitscalenerissacompostmainiteksenakasinggandabelievedagilitycadenatvsmapaikottodaylalawiganbadingviewsupworkdigitaldingginsusunodpreviouslyareastuffeddulatransporthudyat