Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Leukemia can affect people of all ages, although it is more common in children and older adults.

2. Taon-taon ako pumupunta sa Pilipinas.

3. Facebook Marketplace is a platform where users can buy and sell items locally.

4. Please add this. inabot nya yung isang libro.

5. Malapit na ang pyesta sa amin.

6. Pede bang itanong kung anong oras na?

7. She has a poor credit history due to late payments and defaults on loans.

8. Hindi ako sang-ayon sa mga pangyayari sa paligid natin ngayon.

9. "Palaka?" nagtatakang tanong ng binata

10. Les personnes âgées peuvent avoir besoin de soins médicaux réguliers pour maintenir leur santé.

11. Sa pagsasagawa ng outreach program, ang bayanihan ng mga organisasyon ay nagdulot ng pag-asa at pag-asa sa mga benepisyaryo.

12. Leukemia can be caused by genetic mutations or exposure to certain chemicals or radiation.

13. Ariana Grande is also an advocate for mental health awareness, openly discussing her experiences with anxiety and PTSD.

14. I am working on a project for work.

15. Gaano katagal niyang hinintay ang pakete?

16. Napaluhod ang datu kasama ng kawal.

17. Ang pag-asa ay nagbibigay ng lakas sa mga tao upang harapin ang mga pagsubok at mga hadlang sa kanilang buhay.

18. Les enseignants doivent évaluer les performances des élèves et leur donner des feedbacks constructifs.

19. El agricultor cultiva la tierra y produce alimentos para el consumo humano.

20. Ang gubat ay puno ng iba't ibang magaganda, makukulay, at mababangong mga halamang namumulaklak.

21. Panalangin ko sa habang buhay.

22. Ada juga tradisi memotong tali pusar setelah kelahiran, yang dianggap sebagai tindakan penting untuk menjaga kesehatan bayi.

23. Mahilig siya sa pag-aaral ng mga klasikong akda ng panitikan.

24. What goes around, comes around.

25. Nakita ko ang aking guro sa mall kanina kasama ang kanyang pamilya.

26. Nang biglaang magdidilim ang paligid, nahirapan akong makita ang daan pauwi.

27. Pakibigay sa amin ang detalyeng kailangan para maayos naming magawa ang proyekto.

28. Ang pangungutya ay hindi magbubunga ng maganda.

29. The culprit who stole the purse was caught on camera and identified by the victim.

30. A portion of the company's profits is allocated for charitable activities every year.

31. Erfaring har lært mig at tage ansvar og være proaktiv.

32. Sa anong materyales gawa ang bag?

33. Det giver os mulighed for at udføre mange forskellige opgaver, fra simpel redigering af tekst til avancerede beregninger og simuleringer

34. Nasa banyo siya nang biglang nabigla sa tunog ng pagbagsak ng isang kahon.

35. Gumamit si Mario ng matibay na tali para sa kanyang saranggola.

36. Isang araw sa kainitan ng tanghali, isang mahiwagang babae ang dumating at kumatok sa mga pintuan ng mga taong bayan.

37. Birthday mo. huh? Pano niya nalaman birthday ko?

38. Makikita ko si Mrs. Santos bukas.

39. Kebahagiaan adalah perjalanan pribadi yang unik bagi setiap individu, dan penting untuk menghormati dan mencari kebahagiaan yang paling sesuai dengan diri sendiri.

40. Smoking is more common among certain populations, such as those with lower socioeconomic status and those with mental health conditions.

41. Bukas na bukas din ay kakain tayo sa labas.

42. Grabe ang lamig pala sa Japan.

43. Nagpasya akong tumigil at magpahinga nang magdidilim na ang paligid dahil sa sobrang pagod.

44. Muli niyang itinaas ang kamay.

45. Amazon has been involved in the development of autonomous vehicles and drone delivery technology.

46. Der er mange forskellige former for motion, herunder aerob træning, styrketræning og fleksibilitetstræning.

47. Hugh Jackman is best known for his portrayal of Wolverine in the "X-Men" film series and his Tony Award-winning performance in the musical "The Boy from Oz."

48. Basketball is a team sport that originated in the United States in the late 1800s.

49. The Watts Towers, a collection of unique and intricate sculptures, are a testament to the city's artistic expression.

50. Nasan ka ba talaga?

Recent Searches

high-definitioneducationdennejenaroselleltolumilingonmarmaingutilizarvetomaibalikmayamanwastekinantapanindangbalangnahihilokanandibadisseshinesaffiliatemagbabakasyonpagpapakainmakahingihverconsumekingdompatunayansonidohappeneddailyyarifrescokahilinganlenguajeponglegacybumabagbilibbinatakpaskongcarriednasabingorderineuphoricarbejdermayroonhojasbarokaboseslookedosakabigyanbuenatupelofriendsbutchhetochooseyatamedyoboholpasalamatanangkanparaisomagpuntafuryeahduondeterioratemaestromenosiniwanmakisigubodsantotonightreplacedseriousmais1787bitiwanweddingspareamparoboracayelvisattentionipaliwanag1876cupidmestinantokfianaghinalapinatidexcuseresignationcitizensgrewilangadversepiecesgatheringbusiness,kadaratingwalngsaidteleviewingkainlamankumakalansinghydeloutlinesvocallegendsmasdancardmaitimsumamatonlargersumabogmallpostcardbobohigitsellcommunitylamesaeffortsbossulamshowsterminotelangcontestbarnesfeedback,batodetteorugasabihingdawahitcivilizationpropensoallowingbabesjudicialbuwanmanuscriptbinawiitongsinunodmadaminakablueofferataquesbartuwidtabisinceagilitymakilingcountriesjuiceaudittabasaltperfectpostergrahammanonoodagaofficepumuntareducednatingalachadoueherunderwidespreadwordsaalistalentednyemoodpagbahingipagamotstarlasingerowatchingsumasambapitakatsinelasibabawdemocracymartes