Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Hindi ko gusto ang kanyang maarteng pananalita tungkol sa kanyang pagkain.

2. Umayos naman ako ng higa at yumakap patalikod sa kanya.

3. Talagang dito ho sa palengke'y maraming naglipanang batang gaya niyan

4. My husband surprised me with a trip for my birthday, and I couldn't be happier.

5. Ang mga magsasaka ay nagtatanim ng palay.

6. Holy Week is a time of introspection and reflection, as Christians remember the sacrifice of Jesus and contemplate the meaning of his teachings and message.

7. Ang mga senior citizen ay dapat na itinuring at respetuhin dahil sa kanilang karanasan at kontribusyon sa lipunan.

8. Hinde ko dala yung cellphone ni Kenji eh.

9. Terima kasih. - Thank you.

10. La tos crónica puede ser un síntoma de enfermedades como la bronquitis crónica y la enfermedad pulmonar obstructiva crónica (EPOC).

11. Durante el invierno, se pueden ver las auroras boreales en algunas partes del mundo.

12. Mahirap makipag-usap sa mga taong mailap at misteryoso.

13. En mi jardín, cultivo varias hierbas como el tomillo, la albahaca y el perejil.

14. Naalala nila si Ranay.

15. John Adams, the second president of the United States, served from 1797 to 1801.

16. I admire the perseverance of those who overcome adversity.

17. Ang mga bata ay lumabas ng paaralan nang limahan.

18. In conclusion, the telephone is one of the most important inventions in human history

19. L'intelligence artificielle est un domaine de l'informatique qui vise à développer des systèmes intelligents.

20. Nakinig ang mga estudyante sa guro.

21. The early bird catches the worm.

22. The credit card statement showed unauthorized charges, so I reported it to the bank.

23. A father's love and affection can have a significant impact on a child's emotional development and well-being.

24. Det har også ændret måden, vi producerer ting og øget vores evne til at fremstille emner i større mængder og med højere præcision

25. Don't worry, it's just a storm in a teacup - it'll blow over soon.

26. Patients may experience pain, discomfort, and anxiety during their hospital stay.

27. Napatingin ako sa kanya, Bakit naman?

28. Les enseignants ont un impact majeur sur la vie des élèves et leur réussite scolaire.

29. Nakakalunok siya nang malalim at maririnig mo ang kanyang halinghing.

30. Ang malawak na kagubatan ay isang magandang halimbawa ng isang ekosistema na mayabong.

31. Los héroes son aquellos que demuestran una actitud valiente y una voluntad inquebrantable.

32. Påsken er også en tid, hvor mange familier samles og fejrer sammen.

33. Anong oras natutulog si Katie?

34. Lumiwanag ang buong silid nang buksan ang ilaw.

35. The momentum of the athlete propelled him across the finish line.

36. Mahalaga ang pagtitiyaga sa bawat bagay na ating ginagawa, datapapwat ay may mga pagkakataon na hindi natin nakukuha ang inaasahan nating resulta.

37. Nagsisilbi siya bilang librarian upang magbigay ng access sa kaalaman sa mga nagbabasa ng kanyang aklatan.

38. Taksi ang sasakyan ko papuntang airport.

39. Dette er med til at sikre, at Danmark har en bæredygtig økonomi, der er i stand til at bevare ressourcerne til fremtidige generationer

40. Det er vigtigt at have en forståelse af sandsynligheder og odds, når man gambler.

41. Masyadong maaga ang alis ng bus.

42. Las heridas pueden ser causadas por cortes, abrasiones o quemaduras.

43. Itinago ko ang mga sulat para sa inyo.

44. Hindi ko naiintindihan kung bakit nila gustong gawin ito kaya ako ay tumututol.

45. Inflation kann die Preise von Vermögenswerten wie Immobilien und Aktien beeinflussen.

46. Puwedeng dalhin ng kaibigan ko ang radyo.

47. La pintura es una forma de expresión artística que ha existido desde tiempos antiguos.

48. Pumunta sila sa Zamboanga noong nakaraang taon.

49. Masakit ang ulo ng pasyente.

50. Ayos ka lang ba mahal ko, bakit parang namumutla at namamayat ka? tanong ng binata.

Recent Searches

restauranthigh-definition11pmgabingdietsipasigekruspariflaviomansanaszoomelectoralenergystomeanmarumininyongmagbabagsikannataongmariopanaysubalitsaidespigaskantonooguhit1787pingganpunung-punocriticssumasambasinipangdalandanasulahitgeararghoutpostmaaringvotesnagreplyloritraditionalpakpakkalanpicswordsstrengthhelpfulbumugadelenuclearellateksticonlulusogkararatingmakapagempakemallsstudentoverviewbinge-watchingintobooksbroadbakeceshighdollarconsiderartipidlockdownsulingandevicesroomawaremakeslearnmalakingfeedbackappgraduationrelevantdoonupworkpresentaprogressincludecertainguidetypesbetweenlasingamazonstyrergeneratepagkakapagsalitanag-uumigtingtsinatonettepedromerrymateryalesnag-emaildomingotherapygandahanagwadormaihaharapsundaefestivalesbuung-buokawalankanilaakingperoaregladoparaangbutastillnag-aalangankasintahanumiinommabuhaykumakainkaliwapagkainnabigaymagkabilangkristoumibigtilakaninonghealthforskelmatamiskinakabahancigarettenapapatinginkasaysayannaka-smirkbusiness:naggalabarroconasilawadversebarnesibinaonbusyangcryptocurrency:hinihilingnilulondidpigitransitbulsaadditionallynaisubobeinteaddingeditorturonpanigbutterflyibabawkambingbanalestadosbihiramabigyanmatutongakmangmaidargueradyopagbabagong-anyonagpalalimmagkasinggandahinagud-hagodpagka-maktolnaninirahannagngangalangnakakatawaunibersidadbrindaragawproudibinubulongkapangyarihangmagpaniwalapanghabambuhaygayunmanpatutunguhanmakakatakassang-ayondagat-dagatanmatustusan