Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Der er mange forskellige former for motion, herunder aerob træning, styrketræning og fleksibilitetstræning.

2. Sueño con tener un estilo de vida saludable y activo. (I dream of having a healthy and active lifestyle.)

3. The act of forgiveness requires empathy and understanding, allowing us to see beyond someone's mistakes and recognize their humanity.

4. Los powerbanks pueden prolongar la duración de la batería de un dispositivo móvil cuando no hay acceso a una toma de corriente.

5. Sa ngayon, makikita pa rin ang kahusayan ng mga gagamba sa paghahabi ng kanilang mga bahay.

6. Hindi dapat tayo magpaplastikan dahil mas makakabuti kung magiging totoo tayo sa isa't isa.

7. Matagal na kitang nakikitang namumulot ng mga kahoy sa gubat na ito.

8. I got my sister a cake and wrote "happy birthday" in frosting on top.

9. Tulad ng dapat asahan, bumuhos na ang malakas na ulan.

10. Las plantas anuales completan su ciclo de vida en un solo año, desde la germinación hasta la producción de semillas.

11. The photographer captured the essence of the pretty lady in his portrait.

12. Mengatasi tantangan hidup membutuhkan ketekunan, ketabahan, dan keyakinan pada kemampuan kita sendiri.

13. Gusto mo talagang maputulan ng card? pagbabanta ni Maico.

14. Hakeem Olajuwon was a dominant center and one of the best shot-blockers in NBA history.

15. La internet ha cambiado la forma en que las personas acceden y consumen información en todo el mundo.

16. Paborito nyang panoorin ang Baby shark sa youtube.

17. John and Tom are both avid cyclists, so it's no surprise that they've become close friends - birds of the same feather flock together!

18. Sayang, jangan khawatir, aku selalu di sini untukmu. (Don't worry, dear, I'm always here for you.)

19. Gutom ako kasi hindi ako kumain kanina.

20. Es importante mantener las heridas cubiertas y protegidas de la suciedad y los agentes irritantes.

21. Dalam Islam, doa yang dilakukan secara berjamaah dapat meningkatkan kebersamaan dan kekuatan jamaah.

22. Ipinahid ni Nanay ang gamot sa bungang-araw ng anak.

23. Magkasamang tutungo sa lugar na walang sakit, walang gutom, walang hirap.

24. Sa gitna ng kaniyang pag-aaral, napadungaw siya sa katabing silid at nakita ang kanyang kaibigan.

25. Pneumonia can be life-threatening if not treated promptly.

26. Masaya naman talaga sa lugar nila.

27. She admires the philanthropy work of the famous billionaire.

28. Technology has also played a vital role in the field of education

29. Traveling to a conflict zone is considered very risky.

30. It's considered bad luck to say "good luck" to an actor, so instead we say "break a leg."

31. El equilibrio entre la ingesta de calorías y la actividad física es importante para mantener un peso saludable.

32. It was supposed to be a surprise promotion, but the boss let the cat out of the bag during a meeting.

33. Sate adalah makanan yang terdiri dari potongan daging yang ditusuk pada bambu dan dibakar dengan bumbu kacang.

34. The power of a single act of kindness can be immeasurable in its impact.

35. Det kan være svært for transkønnede personer at finde støtte og accept i deres familie og samfund.

36. Kung walang tiyaga, walang nilaga.

37. Napapalibutan ako ng poot habang pinagmamasdan ko ang mga taong nagtataksil sa akin.

38. John Quincy Adams, the sixth president of the United States, served from 1825 to 1829 and was the son of the second president, John Adams.

39. A new flyover was built to ease the traffic congestion in the city center.

40. Dito ang mga lalaki at doon ang mga babae.

41. Børn er en vigtig del af samfundet og vores fremtid.

42. They are not hiking in the mountains today.

43. The hiking trail offers absolutely breathtaking views of the mountains.

44. At sa kanyang paglayas, naligaw siya sa gubat at inatake ng maraming alamid.

45. Fødslen er en tid til at fejre og værdsætte kvinders styrke og mod.

46. Nakakapagtaka naman na hindi nya ito nakita.

47. Hendes karisma er så fascinerende, at alle omkring hende bliver tiltrukket af hende. (Her charisma is so fascinating that everyone around her is drawn to her.)

48. Lumiwanag ang silangan sa pagsikat ng araw.

49. Sa bawat salaysay ng nakaligtas, maririnig ang kanilang hinagpis sa trahedya.

50. Hinalungkat na niya ang kahong karton na itinuro ng ina.

Recent Searches

high-definitionleoisugamahahabagenelapitanjoshsinapaklumahokdrayberrobotictransitjerryklimapakpakchessbiyassagingdecisionsochandocandidatecleanrevolucionadoposterpresssalarinzebramaaringmabutilungkotuwakinakalangbilingdulolimitdeclarefeedbackservicestugoniniindakapilingemphasizedcontrolaexamplebituinnapilingtools,pangulosuccessdarnatumalabasaahhhhidaraanhaltnagpapaniwaladebatescasavaliosaproudriegawasakmaisaksidentepersonmateryalesimaginationelecteddagokumarawbastontinigilannagulatlungsodsabihingwatawatyoutube,madalasnahihilotawadkissdalhanpaglalayagnakapagreklamotindanatuwamaariaccuracychinesepinansinsurveysmadurastsinalandasinterestbigongngisiiigibginanghandaanexecutivekatapatscottishlayasmag-anaklordhydelcombinedmakikipag-duetopamagatvideotabasfigurenerissakakuwentuhannagtitiispagkakapagsalitapagpapakalatnagsisipag-uwiansponsorships,nasaanimeldapadabogpamburapamanhikankapangyarihangsikre,erlindanakauponakagawianmagkasintahannagmungkahirequierentinutoppagkatakotkubyertospagkalitonamumulotnakikiamakapalagsasamahanprimeroskumakantadisfrutartumunogvillagemaipapautangmakakabaliklumayopagtingingandahanpuntahanumiyakberegningernatabunano-onlinenagagamitbalediktoryanpaghangamanahimiknakatitigkargahanbusiness:binitiwannakauslingika-50magkabilangmahalpropesorgawainpagbibiropromisesasapakinmakabalikkauntiutilizanjolibeeniyonnasunogmaynilaakmangbarangaymagigingbinatilyoinfusioneskaybilisshadesawitinpositiboturonpulongadmiredmayabangsurroundingsnapapikitapologeticculpritpeppyipinanganaksmile