Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Lazada is an e-commerce platform that operates in Southeast Asia.

2. Ang mga kawani sa serbisyo-publiko ay dapat na itinuring bilang mga tagapaglingkod ng bayan.

3. Ang sinabi ng Dakilang Lumikha ay natupad.

4. Mange mennesker deltager i påsketjenester i kirkerne i løbet af Holy Week.

5. Nasarapan ako sa luto ni Chef Josh.

6. Hindi ko nakita ang magandang dulot ng kanilang proyekto kaya ako ay tumututol.

7. Peer-to-peer lending: You can lend money to individuals or small businesses through online platforms like Lending Club or Prosper

8. Pinaliguan ng malamig na tubig ang bata na may bungang-araw.

9. Coffee has a long history, with the first known coffee plantations dating back to the 15th century.

10. Yehey! si Mica sabay higa sa tabi ko.

11. Magalang na nagsabi ang estudyante ng "po" at "opo" sa kanyang guro bilang pagpapakita ng respeto.

12. During hospitalization, patients receive medical care from doctors, nurses, and other healthcare professionals.

13. Women have shown remarkable resilience and strength in the face of adversity and oppression.

14. It is a common phenomenon experienced by individuals who feel a strong emotional pull towards parenthood and starting a family.

15. Mahusay maglaro ng chess si Wesley.

16. At være bevidst om vores handlinger og beslutninger kan hjælpe os med at undgå at skade andre og os selv.

17. Les travailleurs peuvent travailler dans des environnements différents, comme les bureaux ou les usines.

18. Magtaka ka na kung hindi pa sya umuuwi bukas.

19. Rapunzel is a girl with long, magical hair who is locked in a tower until a prince comes to her rescue.

20. The credit union provides better interest rates compared to traditional banks.

21. OMG. Makalaglag-panty si Kuya!!

22. Sa paglipat niya sa ibang bansa, kinailangan niyang mag-iwan ng mga kaibigan at pamilya.

23. The song went viral on TikTok, with millions of users creating their own videos to it.

24. Palibhasa ay madalas na masigasig sa pagtuklas ng mga bagong kaalaman at ideya.

25. Nagpagupit ako sa Eclipxe Salon.

26. Investment strategies can range from active management, in which an investor makes frequent changes to their portfolio, to passive management, in which an investor buys and holds a diversified portfolio over the long term.

27. John and Tom are both avid cyclists, so it's no surprise that they've become close friends - birds of the same feather flock together!

28. Good things come to those who wait.

29. Sinundan ito ngunit nawala nang sumuot sa nakausling ugat ng puno.

30. He collects stamps as a hobby.

31. Ang mga kasal ay karaniwang nagaganap sa mga simbahan, katedral, o sa mga magagarang venue.

32. Lazada has partnered with local brands and retailers to offer exclusive products and promotions.

33. Nakakamangha ang mga tanawin sa isla.

34. Inakalang magugustuhan ng lahat ang ideya niya, pero tinanggihan ito.

35. May mga pagkakataon na kinakailangan mong hiramin ang isang sasakyan para sa long-distance travel.

36. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

37. La internet ha cambiado la forma en que las personas acceden y consumen información en todo el mundo.

38. Madami talagang pulitiko ang kurakot.

39. Mula sa tuktok ng bundok, natatanaw ko ang magandang tanawin ng kapatagan.

40. Ang kuripot mo naman, minsan lang ako magpalibre eh.

41. Sinabi naman ni Apollo ang mga dapat gawin.

42. Sa kabila ng kanyang tagumpay, may bahid ng lungkot sa kanyang mga mata.

43. Sa panahon ng kalamidad, mahalaga ang bayanihan upang mapabilis ang pagtulong sa mga nangangailangan.

44. Sweetness can be found in a variety of foods and beverages, such as candy, soda, and fruit juice.

45. Ang mailap na impormasyon ay kailangan pag-aralan ng mabuti upang maiwasan ang pagkakamali.

46. Dapat lamang kayong maging kauri ng hayop, ang wika ng babaeng diwata pala ng ilog.

47. Ah yun ba? Si Anthony, taga ibang department.

48. Der er mange forskellige rollemodeller og inspirationskilder for unge kvinder.

49. Ang aming angkan ay may natatanging kultura at mga paniniwala.

50. Es importante limpiar y desinfectar las heridas para prevenir infecciones.

Recent Searches

maistorbohigh-definitionbingowordconectadosorugafakebuwaldaaneveningtiposmovingsimulaexitdancekukuhauniquenakapasaviewsjunionegativenapaplastikannagbasanag-googlepaglalayagtinatawagpinapasayamagagandangaraytahananmagulayawkabighamagawadisyemprewhilepangakoanteslupainandoykulotmaalwangfriendskarapatanpaulit-ulitamerikaisugatoypaatabinggaphallagosemailhighestcurrentnakiramaybituinpagpapatubomakapaibabawgobernadornagmamaktolhinagud-hagodculturananghihinamadnagsusulatmagbabagsikmakidaloiintayineconomypagkapasoknahawakanpagkuwajobspagpapautangmakangitihubad-baropagpapasanmagpaliwanagkapangyarihanpagtiisanmusicianmagasawangmag-asawanamulaklaklumalakipinagalitannagpapakainmagkakagustomang-aawitmanlalakbayressourcernenakaka-incrucialpagtataasmagpapagupitnakapasoknagmistulangnakatulognakatapatmahihiraphampaslupapupuntahanbestfriendkapamilyanakayukonapakasipagencuestastinakasantemparaturapinagawapandidiripaki-chargebisitalalakinananalongnagcurvepaki-drawingtumagalbusinessespinuntahanmagtagoyumuyukomagpahabatindaintensidadhawaiiengkantadangsabihinlumakaspamasahekayabanganhalu-halomaipapautangnareklamopag-itimsuzettepundidoumiibignamuhaypaninigastumaposnabuhayedukasyonintramurosnagsinenagbibiromusicaleskumirotnakabibingingkumpletomayrecordedinilingtakembricosmabigyanlikodkamalianpanginoonna-curiousmahahawatamarawnationalbahagyapapuntangisusuotbinuksansignalkatagangtatlongmatangkadbantulotkaninagawaaustraliaipinangangaksisentapananakitbumalikgusalibayaniitinaassandalingtawanewspapersanumanbaguiokumustatondoturonarabiananoodumibiganilamatalimligaligpamanbagalhotelarte