Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Matagal na kitang pinapanood at ngayon lang ako maglalabas ng katotohanan - may gusto ako sa iyo.

2. Los sueños son una forma de imaginar lo que podemos ser y hacer en la vida. (Dreams are a way of imagining what we can be and do in life.)

3. Ah salamat na lang, pero kelangan ko na talagang umuwi.

4. She is designing a new website.

5. Ang mga manggagawa nagsisilbi sa kanilang kumpanya upang magtrabaho at kumita ng pera.

6. Additionally, television has also been used as a tool for educational programming, such as Sesame Street, which has helped to teach young children reading, writing, and math

7. Bell's telephone consisted of a transmitter, which converted sound into electrical signals, and a receiver, which converted the signals back into sound

8. Users can like, comment, and share posts on Instagram, fostering engagement and interaction.

9. In addition to his NBA success, LeBron James has represented the United States in international basketball competitions, winning two Olympic gold medals in 2008 and 2012.

10. Der er mange forskellige former for motion, herunder aerob træning, styrketræning og fleksibilitetstræning.

11. Hindi ko alam kung kakayanin ko, pero sana pwede ba kitang mahalin?

12. Madalas na may mga internasyonal na konferensya na ginaganap upang mapag-usapan ang mga usaping pangkapayapaan.

13. mga yun. Ang mahalaga ay makapagempake ako agad.

14. Hindi nakagalaw si Matesa.

15. Itinaob niya ang kaunting nasahod na balde at ang tubig ay gumapang sa semento at umabog sa kanilang mga paa ni Ogor.

16. La crisis económica produjo una gran inflación que afectó a los precios.

17. Menciptakan keseimbangan antara pekerjaan, waktu luang, dan hubungan sosial membantu meningkatkan kebahagiaan.

18. Ang tarangkahan ng aming tahanan ay kulay pula.

19. Les soins de santé de qualité sont un droit fondamental de chaque individu.

20. Ang pagtulong sa iba o pagbibigay ng serbisyo ay isang nakagagamot na karanasan na nagbibigay ng tunay na kaligayahan.

21. Tila siya ang paboritong estudyante ng guro.

22. Nagliwanag ang buong paligid at naging abo ang katawan ni Matesa.

23. Pakibigay na lang ang mensahe ko kay Miguel kung hindi ko siya maabutan.

24. Hinanap nito si Bereti noon din.

25. He has been meditating for hours.

26. Nang marinig ang tawag ng nanay niya, kumaripas ng uwi ang batang naglalaro sa labas.

27. Es importante cosechar las zanahorias antes de que se pongan demasiado grandes.

28.

29. They are not attending the meeting this afternoon.

30. Menos kinse na para alas-dos.

31. Huh? Anong wala pa? nagtatakang tanong ko.

32. The movie was rated R, and therefore she wasn't allowed to watch it.

33. The children are playing with their toys.

34. Masarap maligo sa swimming pool.

35. His influence continues to be felt in the world of music, and his legacy lives on through the countless artists and fans who have been inspired by his work

36. Les employeurs offrent souvent des avantages sociaux tels que l'assurance maladie et les congés payés.

37. Sa ilang saglit ang matandang babae ay naglaho at ang lugar na dating kinatitirikan ng kanyang bahay ay naging lawa.

38. A lot of rain caused flooding in the streets.

39. Ang poot ay sumisindi sa aking puso sa tuwing naalala ko ang mga pagkakataon na ako'y iniwan at sinaktan.

40. Different religions have different interpretations of God and the nature of the divine, ranging from monotheism to polytheism and pantheism.

41. Naglakad kami sa gubat na mayabong ng mga punong-kahoy, at naramdaman namin ang sariwang hangin.

42. Makalipas ang siyam na buwan, isinilang ang isang napakalusog na batang babae.

43. Sumama ka sa akin!

44. The company's losses were due to the actions of a culprit who had been stealing supplies.

45. The bride looked stunning in her wedding dress, truly a beautiful lady.

46. Kumirot ang dibdib ko sa naisip.

47. Sabay sabay na nagtanghalian ang mga estudyante sa canteen.

48. The acquired assets included a portfolio of real estate properties.

49. In recent years, the telephone has undergone a major transformation with the rise of mobile phones

50. Ang pagpapakain ng mais sa tamang oras at pag-alaga sa mga halaman ay magbibigay sa iyo ng masaganang ani

Recent Searches

high-definitionpaghingiorugasinimulanayamatagpuanctilessellmarahilideyamagsusuotmasilipelenaauditjolibeearaw-arawmagkakaanaksalubongdistancesabihinkalayuanlandasstocksnapakadaigdigkinikitanatitiyakalinemailhanapinpondocuentalayastindachavitkasinatingpaghusayancorrectingyumanignapakasinungalingnapaangatpuedensumasayawngayonpagkabuhayagilatalentnilalangmalakaskasawiang-paladsurroundingskalupilamansikomatesainfusionesgapartistoktubreculturelalabhanisinuotkusinaisipbusnakatigilrenaiamagbibigaysigapagkagisingpatutunguhanbihasainataketambayankombinationunattendedkinabibilangankasingnagagamitmanlalakbaytumamapaghahabitagaytaystringthoughtscubiclemayamangmatangkadpagpapatubokare-karekaniyahihigitskillsvetopasinghaldinadaananbintanatanghalikinahuhumalinganalas-doseedsaimportantessinagotmagagandangmariepaghahanaptradisyonnaputolnag-iisaadvertising,kulisappronounkagipitankapatawaranmagtanghalianyanspeedkulotmagsusunuranendclientssagotso-calledvoteslarawanednasisterdonationsinalagaanlibagneaulannaroonnocheguronagpapasasaentry:kabighaevnedalhaneducationhallbritishtatagalbilihinagoskuwintasgreatlymovingkababaihananitobansatinylagunaprogrammingmayroonbawasementeryokatagangpanghabambuhayritodagligeikatlongindiagratificante,naintindihanbagamatibinilibagaysasasusisilbingnauliniganideologiesstudentsmonsignoryatarequireilinghitikogsåasomedicalescuelasbusiness,regularmentepalanami-missnapasobramemoriabibigyanlandetinaymapagbigayikukumparamayabongginugunitapalapagnakapagtapos