Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Bibisita ako sa lola ko sa Mayo.

2. Foreclosed properties can be a good investment opportunity for those who have the time and resources to manage a rental property.

3. Digital microscopes can capture images and video of small objects, allowing for easy sharing and analysis.

4. Dahil sa pagmamahalan ng dalawang pamilya, ang pamamamanhikan ay naging isang masayang pagtitipon.

5. Ang mga nangunguna sa industriya ay kadalasang itinuturing bilang mga eksperto at mga awtoridad sa kanilang larangan.

6. Nag mungkahi naman ang Mayor na dapat unahin munang bigyan ng ayuda ang mga senior citizens.

7. Kahit saang parte ng mundo ay may makikita ka pa ring gumagamit ng illegal na droga.

8. Dapat supilin ng pamahalaan ang mga kriminal na nagpapahirap sa mga inosenteng mamamayan.

9. Maraming tao ang naniniwala sa kakayahan ng albularyo kahit hindi ito lisensyado.

10. L'enseignement est un métier noble qui consiste à transmettre des connaissances aux élèves.

11. Nag smile siya sa akin tapos tumango.

12. Marami sa atin ang may mga pangarap sa buhay na nais nating tuparin.

13. Isang binata ang napadaan at tinangkang kumain ng bunga ng puno.

14. Maraming Salamat!

15. Walang nakakaalam kung saan sila napupunta.

16. Sa larangan ng negosyo, ang mailap na customer ay mahirap makuha at panatilihin.

17. Facebook offers various features like photo albums, events, marketplace, and games to enhance user experience and engagement.

18. Ibinigay ng aking mga kaibigan ang kanilang suporta at pagsuporta sa aking mga pangarap.

19. Higupin mo nang dahan-dahan para hindi ka mabulunan.

20. The teacher assigned a hefty amount of homework over the weekend.

21. Drømme kan være en kilde til kreativitet og innovation.

22. El equipo de recolección mecánico es muy eficiente para cosechar grandes extensiones de tierra.

23. Napakalakas ng bagyong tumama sa kanilang bayan.

24. Una dieta equilibrada y saludable puede ayudar a prevenir enfermedades crónicas.

25. Magkaiba man tayo ng landas ay tiyak kong magkikita pa din tayo.

26. Scissors should be kept sharp to ensure clean and precise cuts.

27. Tanghali na nang siya ay umuwi.

28. Sambal adalah saus pedas yang terbuat dari cabai dan bumbu-bumbu lainnya.

29. Katamtaman ang pangangatawan ng nanay ko.

30. Ang mga magsasaka ay nagtatanim ng palay.

31. Der kan være aldersbegrænsninger for at deltage i gamblingaktiviteter.

32. Elije el lugar adecuado para plantar tu maíz

33. Ang guro ang pinagpalaluan ng lahat ng kanyang mga estudyante dahil sa kanyang kabaitan.

34. Claro que sí, estoy dispuesto a aprender cosas nuevas.

35. Mula noong nakilala kita, hindi ko maalis sa isip ko na crush kita.

36. Palibhasa ay mahilig siyang magbasa, kaya marami siyang nalalaman sa iba't-ibang paksa.

37. Maganda ang website na ginawa ni Michael.

38. Nakatanggap ako ng inspirasyon sa mga kanta ng Bukas Palad sa panahon ng pandemya.

39. Maganda ang bansang Japan.

40. Hinugot niya ang kanyang karanasan sa trabaho upang makapagsimula ng sarili niyang negosyo.

41. Sweetness can be addictive and overconsumption can lead to health issues, such as obesity and diabetes.

42. Ang mga dentista ay mahalagang propesyonal sa pangangalaga ng ngipin at bibig, at mahalagang sumunod sa mga payo at rekomendasyon nila upang maiwasan ang mga dental problem.

43. Christmas is an annual holiday celebrated on December 25th to commemorate the birth of Jesus Christ.

44. I received a lot of gifts on my birthday.

45. Risk tolerance is an important factor to consider when deciding how to invest.

46. Ang mga bayani ng kasaysayan ay dapat na itinuring at ipinagbunyi bilang mga pambansang tagapagtanggol at inspirasyon.

47. Holy Week culminates in the celebration of Easter Sunday, when Christians gather to commemorate the resurrection of Jesus and the triumph of life over death.

48. Nakapila ako sa bayad center upang magbayad ng kuryente.

49. Ang pagbasa ng magandang libro ay isang nakagagamot na paraan upang maibsan ang stress.

50. Kumain na kami ng tanghalian kanina.

Recent Searches

edsabecamehigh-definitiontagafakeandamingheardagadilimstaplejudicialallowinghangaringunanfansputaheballeveningprovidebruceamongpocaadverselymonetizingcandidatestagedoonrolledmetodepressipapainitfloorcountriesunopasigawcleankapilingnapilingexampleexportinfinitybetweencablecornerdingdingitlogbathalamatatagpatuloykalalakihanvideos,pagtutolmahigpitmaayosbilangphilippinekamotenag-iyakan1954satisfactionmamanuganginghverawarequicklysteerkanayangomelettegayundinkasonakakalakisampaguitapagpapasakitsugatkalanpangungutyanagsagawaiiyakpaghangamadalinggumandaMalilalakadinireseta1980umiibigmamanhikanmaskianiogsånaantigipinagdiriwangmurangasukalsuloknamaipihitadaptabilityadvertising,larangankategori,pagkalungkotikinabubuhaypinagsikapannagbanggaanhumahangostatawagannapakasipagpagpapatubogayunmannagkakakainkapatawaranmiramalezamagkakaanakposporonagtagisanpinakamagalingmukhatumagalmagtiwalapaghaharutanmensahepamilyadiretsahanguusapannaiyakpagpilimakapalagkalayuannabubuhaypaumanhinkapitbahaytumatakbomagtagohinahanapmarketing:nanangisdadalawminatamisartistmauliniganmaintindihannangyarikanlurantraditionalvegasiniangatmawalaindustriyakaratulangmaghilamosundeniableisinamatanghalireorganizingtinanggalkinakainmatutonag-asaranWaringsagotmaibabalikeleksyoninastabarangaybutaskambingipinangangaksumasakaymalasutlacurtainsmariniglilipadstockslilyparurusahanmatamansalbahetasamaalwangbalinganproducts:binibilanginimbitaelenatinapaygoodeveninggoshkaawayhmmmmakahingianywhereaircontupelodumaansumuotnatandaanmaulitkanan