Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Ang tubig ay kailangan ng tao para mabuhay.

2. Tulala lang rin yung daddy niya sa amin.

3. In recent years, the telephone has undergone a major transformation with the rise of mobile phones

4. James A. Garfield, the twentieth president of the United States, served for only 200 days in 1881 before his assassination.

5. Si Rizal ay kilala sa kanyang pagiging makatarungan at pagiging boses ng mga walang tinig sa kanyang panahon.

6. I'm going through a lot of stress at work, but I'm just trying to hang in there.

7. Madalas siyang sumusulat kapag nag-iisa.

8. Nakaakma ang mga bisig.

9. Nasa Cebu si Trina sa Disyempre?

10. Ako si Minervie! Ang dyosa ng dagat! Dahil sa kasamaan mo, parurusahan kita! Simula ngayon, hindi ka na maglalakad sa lupa

11. Las escuelas son responsables de la educación y el bienestar de los estudiantes.

12. There are many ways to make money online, and the specific strategy you choose will depend on your skills, interests, and resources

13. Kapag pumunta ako, may makakawawa.

14. Sila ay nagsisilbing modelo ng katapangan, katapatan, at pagmamahal sa bayan.

15. The telephone quickly caught on, and by 1878, Bell's company, the Bell Telephone Company, had more than 50,000 subscribers

16. Magkano ito?

17. Namiss kita eh. Sabay ngiti ko sa kanya.

18. Binigyan niya ako ng aklat tungkol sa kasaysayan ng panitikan ng Asya.

19. Nagbigay ng kanyang opinyon ang eksperto ukol kay President Bongbong Marcos

20. Ang kanilang kaharian ay malapit sa isang maliit na gubat na kung saan ay malayang nakakapamasyal ang mayuming kagandahan.

21. Sayangnya, acara itu sudah berakhir. (Unfortunately, the event has ended.)

22. Ang mabangong lotion ay nagbibigay ng pag-aalaga sa balat at magandang amoy.

23. The king's court is the official gathering place for his advisors and high-ranking officials.

24. Samang-palad, tamad ang binatilyong apo, ayaw tumulong sa lola at, araw-araw, bumababa sa baranggay upang makipag-barkada at magsugal.

25. Paano tayo? Di mo pa sinasagot yung tanong ko. aniya.

26. Hoy ano ba! Wag kang pakelamero! galit na sabi ni Cross.

27. My daughter made me a homemade card that said "happy birthday, Mom!"

28. Los héroes son capaces de cambiar el curso de la historia con sus acciones valientes.

29. "A house is not a home without a dog."

30. Sa aming mga paglalakbay, nakakita kami ng mga kapatagan na mayabong na mga pastulan.

31. Hendes skønhed er ikke kun ydre, men også indre. (Her beauty is not just external, but also internal.)

32. Les préparatifs du mariage sont en cours.

33. Bawal magpakalat ng mga hate speech dahil ito ay nakakasira ng kalagayan ng mga taong napapalooban nito.

34. Ang poot ay isang emosyon na dapat kong matutunan na kontrolin at harapin nang maayos.

35. Kehidupan penuh dengan tantangan yang harus dihadapi setiap orang.

36. She is not practicing yoga this week.

37. The patient was advised to limit alcohol consumption, which can increase blood pressure and contribute to other health problems.

38. Ang pag-asa ay nagbibigay ng inspirasyon sa mga tao upang magbigay ng tulong at suporta sa ibang tao.

39. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

40. The computer works perfectly.

41. Durante las vacaciones de otoño, visitamos viñedos para la vendimia.

42. Bakit hindi? ang natigilang pagtatanong ni Mariang Maganda habang pinagmamasdan ang malungkot na mukha ng prinsipeng kanyang iniibig.

43. Unti-unting nakakabangon ang ekonomiya ng Pilipinas matapos tanggalin ang lockdown.

44. Ang sugal ay isang laro ng pagkakataon na kadalasang nagbubunga ng pagkatalo kaysa panalo.

45. If you think I'm the one who broke the vase, you're barking up the wrong tree.

46. Beast... sabi ko sa paos na boses.

47. The job market and employment opportunities vary by industry and location.

48. Den danske kirke fejrer påsken med flere forskellige ceremonier i løbet af Holy Week.

49. Sa mga paaralan, kadalasang nagkakaroon ng mga proyektong pagtatanim ng mga punong-kahoy upang maituro sa mga mag-aaral ang kahalagahan ng kalikasan.

50. Mange transkønnede personer oplever at blive udsat for chikane, mobning og vold på grund af deres kønsidentitet.

Recent Searches

high-definitionjoshuapaboritonghidingchadbasahinhellomahigitkahusayannangangaloggrammarmakabilimagsi-skiingminutostudentspunongkahoybulaklakisinaboyresearch,sigalexanderbilitog,sinenagtalagaipantalopconvertidaslakastamisnatitirauniversitiesipaliwanagnakalockmartesmagworkpantalongtsinelastsakapiergayunpamanintroductiondiaperkawawangcultivalayuninreneparttalentpalakaipapainitsumugodinteligentessakalingdiagnosticsakopnanigasinsidenteemailsulatakonapakahanganakuhangnoblegloriaemocionantekonsultasyonsalu-salomateryalesfestivalessponsorships,culturasdyosabusiness,hitsurasalitangpinagtagposharmaineflaviopakakasalanginawanggreatlymatangkadbecamenakatunghaypagngitiplanning,saritababesnakapaligidibinalitangpagpapasankumanankaniyacolourarawiniibigkwenta-kwentao-onlinetseseriousmagawa1940nagmamadalinovemberbabekilaymauliniganamongnuevoika-50offerkamaliansumisilipnalalabingagadlalakelargelunesalwaysamountdiyannakapapasongmukanagbakasyonwaysnakakatandakinsesunud-sunuranmakakakumakainuminomsaktanpaldaboxdawordernaghubadultimatelymaibibigaypayongskilltagpiangdulotfremtidige1954gitnanakatitighinamoninformationpaskotanimpangalananterminoskills,namalagibeforecreationmasdantungoimpactedisulatmagselosmananalonothingmuchbalediktoryangitaracassandrasolidifyisaacbasagenerabareleasedpigingpandidirispreadtibignag-iinomcompleteinalalayanutak-biyamulpaskongespanyolibinigaygeardevicesikinamataykilalang-kilalabayankonsyertogappaboritopaghalakhakibinentamagpakasalpinilingpangitmagdaansee