Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Sa hinaba-haba man daw ng prusisyon, sa simbahan din ang tuloy.

2.

3. Las hojas de afeitar deben cambiarse con frecuencia para evitar irritaciones en la piel.

4. Malalaki ang ahas na nakakulong sa zoo.

5. Hindi ko alam kung may chance ako, pero ito na - pwede ba kita ligawan?

6. Nationalism can also lead to authoritarianism and repression of dissent.

7. Nagulat ako nang biglaan siyang tumawag at nangumusta sa akin.

8. Sa takip-silim, mas nakakapag-relax ang mga tao dahil sa kalmado at malumanay na hangin.

9. Hun har en figur, der er svær at ignorere. (She has a figure that's hard to ignore.)

10. This can include reading other books on the same topic, interviewing experts, or gathering data

11. Higupin ng basang tuwalya ang tubig sa mesa.

12. In recent years, the telephone has undergone a major transformation with the rise of mobile phones

13. I received a lot of gifts on my birthday.

14. Libre ba si Carol sa Martes ng gabi?

15. Magsasalita na sana ako ng sumingit si Maico.

16. Nakasuot ng pulang blusa at itim na palda.

17. Ayaw mo ba? tanong niya sa malungkot na tono.

18. Hun er utrolig smuk. (She is incredibly beautiful.)

19.

20. Sinabi naman ni Apollo ang mga dapat gawin.

21. Pagdating namin dun eh walang tao.

22. Mabait ang nanay ni Julius.

23. Malapit ang eskuwela ko sa bahay namin.

24. Hindi nawawala ang halaga ng panitikan sa pagpapalaganap ng kultura at kaalaman.

25. Sa tuwing nakikita ko ang aking kabiyak, nadarama ko ang kumpletong kaligayahan sa aking puso.

26. Bilang paglilinaw, ang pagsasanay ay para sa lahat ng empleyado, hindi lang sa bagong hire.

27. Napakababa ng respeto ko sa mga taong laging mangiyak-ngiyak para lang mapansin.

28. Las drogas pueden alterar el estado de ánimo y la percepción de la realidad.

29. TikTok has become a popular platform for influencers and content creators to build their audience.

30. It can be helpful to get feedback from beta readers or a professional editor

31. Ang tubig-ulan ay maaaring magdulot ng pagpapakalma at kapanatagan sa mga tao dahil sa tunog ng ulan at sariwang hangin.

32. Bell's telephone consisted of a transmitter, which converted sound into electrical signals, and a receiver, which converted the signals back into sound

33. The company's stock market value has soared in recent years, making Tesla one of the most valuable automakers in the world.

34. Gusto ko ang silid na may malaking bintana para maaliwalas ang pakiramdam.

35. Indonesia adalah negara dengan keragaman agama yang besar, termasuk Islam, Kristen, Hindu, Buddha, dan lain-lain.

36. Samantala sa malamig na klima, nag-aalaga siya ng mga halaman sa loob ng bahay.

37. Puwede ho ba akong kumain ng baka at baboy?

38. Ano ang pinakidala mo kay Sarita sa Maynila?

39. Isang magdadapit-hapon, habang nagpapasasa si Kablan sa marangyang hapunan, isang uugud-ugod na matanda ang kumatok sa kanyang bahay.

40. Makikitulog ka ulit? tanong ko.

41. Mahilig sya magtanim ng mga halaman sa kanilang lugar.

42. It has revolutionized the way we communicate, allowing us to talk to people anywhere in the world at any time

43. Buti naman. Ayoko mahawaan ng kuto eh.

44. Hindi mo na kailangan ang magtago't mahiya.

45. Oy saan ka pupunta?! Bayad ka na!

46. He gives his girlfriend flowers every month.

47. Gambling er en form for underholdning, hvor man satser penge på en chancebaseret begivenhed.

48. Saan ka galing? Dalawang araw na ako dito ah! aniya.

49. Hinipan-hipan niya ang manipis na dibdib.

50. Ah ganun ba sabi ko habang naka tingin sa cellphone ko.

Recent Searches

revolutionizedt-ibanghigh-definitionsakopwindowlumuwasnapahintopanginoonmaalogKumainSumasayawsaan-saanpresidentformsefficientadvancedartistanag-emaillumayointerpretingproperlydivideshapdiformatnagkakakainmobilepunoLumalangoypaghingiconnectingchadkaguluhanpahahanaphitatopicpetersharingtsakakanilasisentaturismodelegatedUmiyakbusiness:kasalukuyankinumutanresortbenefitsexpertisepananimextremistnagdadasalmag-inaNatulogkaniyasenatekabosesmahiwagangkayamandirigmangbalotilihimganitoanitonabigyanpatulogreorganizingwatchingsampungsubalitnaglalabaoutlinenababalotwaitkaibiganbandangunitpinabayaankatulongbusiness,stockskumpletopinapataposnasagutannakatuonkungpoongmagtiwalalalimnamatayhinamaklumiwagnauliniganhalatangnakaririmarimpamahalaanpasangnagngangalangkastilalikodsinabipaliparintripsinasadyaumiinitnagtakasantosfloormarianbobobudokkamiassinundanpronoungastalagateammasaganangcenterwasaksinoledatensyongganuniyongnodmaihaharapmatalikparaisokasamawikainastaumalisumiwassinepangalannagagalitkanikanilangmagpasalamatyumuyukomakuhagawainkutodbinilingtumirastateupangfamilyawitindustpannapapikittawanantabamalilimutinexhaustionkayanglinggomasarapconcernsinabot1000h-hoymatulogahasmarketingpangkattotoongnaiiniskabutihansumagotsalapisinagalitbagkus,gayunpamanpandemyakinakailangangtrueiintayinoverallsamfundpartsnatuwainaloksalamangkeroasiaticbutchusokalakibirdstinanggalnaiilaganaguaroofstockmagkikitahospitalbisigdingdingkanayangtipid