Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Humingi ng paumanhin ang inang makakalimutin subalit nagsiklab sa galit ang anak na sutil.

2. Nalalaglag na ang nagsasanggang kamay.

3. The introduction of the dial telephone in the 1920s further improved the telephone system, as it allowed for faster and more efficient call connections

4. Ang galing nya maglaro ng mobile legends.

5. Ang paglapastangan sa mga batas at regulasyon ay nagdudulot ng kawalan ng disiplina sa lipunan.

6. Kumaripas ng uwi si Pedro matapos niyang marinig ang masamang balita.

7. Los héroes pueden tener habilidades sobresalientes, pero también muestran compasión y empatía hacia los demás.

8. Ang daming palamuti ang nakalagay sa kanyang cake.

9. Ang tanda niyang laman ng kanyang kalupi ay pitumpong piso na siyang bigay na sahod ng kanyang asawa nang sinundang gabi.

10. Mas mabuti pang magpakatotoo at huwag maging masyadong kababaw sa mga bagay.

11. Maaaring magdulot ng pangmatagalang epekto sa kalusugan at kaligtasan ng mga tao ang digmaan.

12. Ano ang pangalan ng babaeng buntis?

13. Magsasalita pa sana siya nang biglang may dumating.

14. El invierno comienza el 21 de diciembre en el hemisferio norte y el 21 de junio en el hemisferio sur.

15. Work can also provide opportunities for personal and professional growth.

16. Limitations can be a result of fear or lack of confidence.

17. Ilan ang mga puno sa bakuran ninyo?

18. Ang pagpili ng mga kasuotan para sa kasal ay dapat ayon sa tema ng kasal.

19. Gusto ko ang pansit na niluto mo.

20. Magdoorbell ka na.

21. Las hojas de los árboles cambian de color en otoño.

22. Bakit ho, saan ninyo ko dadalhin?

23. Ang hina ng signal ng wifi.

24. At habang umiisod ang pila, nararamdaman niyang lalong umiinit ang sikat ng araw.

25. Nagpagupit ako sa Eclipxe Salon.

26. Ibinili nya ng maraming diaper ang kanyang anak.

27. Ang mga natatanging likhang-sining ay dapat na itinuring bilang mga obra ng kahusayan at katalinuhan ng mga artistang naglikha.

28. Napuyat na ako kakaantay sa yo.

29. Muchas personas utilizan las redes sociales para expresar sus opiniones y puntos de vista.

30. May konsiyerto ang paaralan at ang mga guro ang magiging bida.

31. She has been running a marathon every year for a decade.

32. La labradora de mi primo es muy protectora de la familia y siempre está alerta.

33. Ailments can be diagnosed through medical tests and evaluations, such as blood tests or imaging scans.

34. Ang pakikinig sa malumanay na himig ng mga instrumento ay nagpapalapit sa akin sa isang matiwasay na mundo.

35. Hindi pa rin siya lumilingon.

36. Oo na. Umuwi ka na. Di ko na ipapaputol ang card mo.

37. Ininom ni Henry ang kape sa kusina.

38. Kailangan nating magpakatotoo sa ating mga nararamdaman, samakatuwid.

39. Nag silbing inspirasyon si Andres Bonifacio laban sa mga inaapi.

40. In recent years, the Lakers have regained their competitive edge, with the acquisition of star players like LeBron James and Anthony Davis.

41. Ang albularyo ay gumamit ng langis at kandila upang tukuyin kung may masamang espiritu sa bahay.

42. Es común usar ropa abrigada, como abrigos, bufandas y guantes, en invierno.

43. Erfaring har lært mig at tage ansvar og være proaktiv.

44. Ang mga pook na mayabong na mga bulaklak ay karaniwang pinupuntahan ng mga turista.

45. El ajedrez es un pasatiempo que disfruto desde niño.

46. Oo, kinanta 'to sakin ng isang babaeng kinaiinisan ko...

47. Hindi ka nag-iisa, mayroon kang kaulayaw na handang tumulong sa iyo.

48. He has been named NBA Finals MVP four times and has won four regular-season MVP awards.

49. Some kings have been known for their military conquests, such as Alexander the Great and Napoleon Bonaparte.

50. Hindi ko malilimutan ang pagkanta namin ng "Hindi Kita Malilimutan" ng Bukas Palad sa aking graduation.

Recent Searches

high-definitionsegundocryptocurrency:makatulogdraft,mulighederupworkumaraweskwelahanhaltchecksgitaragameskalabawpinagpatuloynagsibilibooksgumuhitagadendingnowmaarimagdaraosmatipunobagkusayudascaleallowedmind:merlindanaiisipanibersaryomalambingatensyonrobertcoaching:specializedbasahinmagnakawnagbiyayakamalianpadabogprimerosalas-doskasinggandasasakyanhumalonaiilangmahinangsuriinlibertynoongnapatayolumiwanagmiraprincipalesparusahanbarangaysumisilipinintaysinabilabisnagkasakitpakisabimagpa-ospitalanimoydulotutak-biyalorinatingalamarienatulalakabilangmagtipidprobinsiyasumimangottiketinyongmodernepagkalipashojasmartiantungosuotunderholderfertilizertamadbawatpa-dayagonalworkshopiloglumakisambitmagandakumulognararamdamanmakalingresearch:kayellapinagkiskissumasakaybotenangagsipagkantahanfianamilipitrimasriyantinapaynakapasabevareseelotarkilapusamatangkadpanghabambuhayinjuryiligtasinvestentrebestfriendindividualsnilayuanpumapaligidnatinhawaiiarturodemocracysummitseguridadipagbilinangapatdanaltrhythmnapuyatwowsilakahong1982mantikamaghatinggabipasokumingitayokolockedpalapagpamagatwashingtonlibagbinilhanoutlinesinakyatnapilinagsisigawrosariomakakasahodkumikinigkakaantayinfluencehagdanartsnakaririmarimsumusunonagbiyahepumatolinagawhmmmmdiagnosesnagpaiyaknagbabababahaysapatanimohalinglingnapansinawarewordsmahiwagasapatossaktandrowingkumustagoingheftytoretewaitmindinakalajosebigotenagbanggaaninstitucionessinimulanibabawnalalamansalbahealas-tresminahaninis