Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Tiyak daw na bibili sila ng mga paninda niya.

2. Ariana is an advocate for animal rights and follows a vegan lifestyle.

3. Kinilig ako pero di ko pinahalata, whatever.

4. Hindi ako pumapayag sa kanilang plano dahil nakikita kong mayroong mga posibleng panganib na maaring maganap.

5. Tumakbo na ako para mahabol ko si Athena.

6. Representatives are individuals chosen or elected to act on behalf of a larger group or constituency.

7. Anong lugar ang pinangyarihan ng insidente?

8. Walang humpay ang pagdudugo ng sugat ng tigre kaya agad agad itong kumaripas ng takbo palayo sa kweba.

9. The Tesla Supercharger network provides fast charging infrastructure for Tesla owners, allowing them to travel long distances with ease.

10. Mayroon pa ho sana akong gustong itanong.

11. In theater, "break a leg" is a way of wishing someone good luck without actually saying it.

12. Les travailleurs peuvent travailler à temps plein ou à temps partiel.

13. Masarap mag-surfing sa dapit-hapon dahil mas malamig na ang dagat.

14. Supportive care, such as blood transfusions and antibiotics, may be necessary to manage complications of leukemia treatment.

15. Hindi niya inaasahan ang biglaang pagbisita ng kanyang kaibigan.

16. Gusto kong sumama sa nanay ko sa tindahan.

17. Ang kamalayan sa mga isyu ng karapatang pantao ay nagpapabukas ng pinto sa pagtugon sa mga pangangailangan ng mga mahihirap.

18. I absolutely agree with your point of view.

19. Ibinigay ko ang aking payo at opinyon upang makatulong sa pagresolba ng problema.

20. Madalas syang sumali sa poster making contest.

21. Ang kagutuman ay laganap sa mga lugar na may kalamidad.

22. Ang taong hindi marunong lumingon sa pinanggalingan, ay hindi makakarating sa paroroonan.

23. Sa pagguhit, mahalaga ang pagpili ng tamang anggulo at perspektiba.

24. Hendes skønhed er betagende. (Her beauty is mesmerizing.)

25.

26. Stop beating around the bush and tell me what's really going on.

27. Many countries around the world have their own professional basketball leagues, as well as amateur leagues for players of all ages.

28. During his four seasons with the Heat, LeBron won two NBA championships in 2012 and 2013.

29. Si Ogor, Impen, pahabol na bilin ng kanyang ina.

30. Les enseignants sont souvent formés dans des écoles de formation des enseignants.

31. Hindi tayo sigurado/nakatitiyak.

32. Sa pagkamatay ng aming alagang aso, kami ay lubos na ikinalulungkot.

33. Ang mga mangingisda ay nagtatanim ng mga alon sa kanilang pagmamahal sa karagatan.

34. Madalas banggitin si Carlos Yulo sa mga balita tuwing may malaking kompetisyon.

35. Hiramin ko muna ang iyong libro para magkaruon ako ng kopya nito.

36. Mahigpit na binabantayan ng mga otoridad ang mga kilalang salarin sa lungsod.

37. Matagal ko nang pinapaliwanag sa kanila ang mga dahilan kung bakit ako tumututol sa kanilang plano.

38. Gusto kong ibigay ang aking buong atensyon sa aking nililigawan upang malaman niya na tunay kong mahal siya.

39. La lavanda es una hierba que se utiliza en aromaterapia debido a su efecto relajante.

40. Foreclosed properties may be sold through auctions, which can be a fast-paced and competitive environment.

41. Hindi mo gusto ang lasa ng gulay? Kung gayon, subukan mong lutuin ito sa ibang paraan.

42. Hindi pangkaraniwang araw ito at kinakailangang magkaroon silang mag-anak ng hindi pangkaraniwang pananghalian.

43. Sino ang kasamang kumanta ni Katie?

44. Agad na natuyo ang dugo hanggang sa naging abo ito at humalo sa lupa.

45. Hindi niya inaasahan ang biglaang promotion na ibinigay sa kanya ng kanyang boss.

46. El arte renacentista fue una época de gran florecimiento del arte en Europa.

47. Limitations can be perceived or real, and they can vary from person to person.

48. Ailments can be treated through medication, therapy, surgery, or other medical interventions.

49. Sa loob ng simbahan, nararamdaman ko ang isang matiwasay na kapayapaan.

50. He admires the honesty and integrity of his colleagues.

Recent Searches

farmhigh-definitionkumbinsihinbarung-barongmakapangyarihangkaaya-ayangpinakamatapatnagkakatipun-tiponpagbabagong-anyonagtatakboalisnganapakahabawifimatapobrengnasasakupannagkasunogkagandahannagkapilatmagtanghaliannakakagalingnakakapasokmagpapabunotikinalulungkotfurydoonkuwadernonakatagokaano-anokapasyahanpaanongnakuhangnalagutanpumapaligidopgaver,nagsmilenaiisiptotoongtumalimhoneymoontumahanmagalangkabutihanmumuntingyoutube,airportproductividadpag-unladbasawaringkastilamabatongpinangalanangnaghilamossay,tennismagsunogkongresoabut-abotmaibibigaylumilipadmaanghango-onlinemarielpalitanpinoymaghatinggabipayongbumagsakadvertisingkampanalabisnabigkasrenacentistanagsilapitnaaksidenteprincipalesbutikihinahanapumigtadasahanskirtnaglokohanmaligayanakapikitmabibingimakausapbihiramaibigaysabonggustongpananakitsteamshipsminervienawalaboyfriendhinahaplosbutihingadicionalesmerryganaaffiliatenakapuntamundomournedcomunicanlalatibokindustrymataaaspatricknilalangnapakahangalarocareerbinibinidialledsinumangcivilizationadoptedclientsheartnumerosaskalakidahilgodspendingavailablealecakesutilflashheftybeyondmereinternalmemorynaninirahanitinalagangbatang-batakapainvisnagsimulaupangbelievedcassandraparoltagumpayganunnanghihinamagtanimwouldnapakasahodsawsawanbayabasskybrasoiiwanbwisitmagtagomaglalabadaanpondomaagangproudanywhereiconicmagwawalajerryforcesbumitawligawanmonetizingsamemulingelviskapilingpinabulaanangmaghihintayperainformationlivescountryescuelaspaulanapaluhakasipresentcelularesnakikihukaytsonggoenglishtaga-ochandobumibilikumembut-kembotkadalasadvancementmagpasalamatnangapatdan