Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Taking unapproved medication can be risky to your health.

2. La tos crónica puede ser un síntoma de enfermedades como la bronquitis crónica y la enfermedad pulmonar obstructiva crónica (EPOC).

3. Alas-diyes kinse na ng umaga.

4. Mahilig maglaro ng video games si Marvin.

5. Sa pagpaplano ng kasal, kailangan isaalang-alang ang oras ng seremonya upang hindi maabala ang mga bisita.

6. Les examens et les tests sont des évaluations importantes pour les étudiants.

7. Parating na rin yun. Bayaan mo siya may susi naman yun eh.

8. Good morning, Beauty! aniya sabay halik sa mga labi ko.

9. Kung may isinuksok, may madudukot.

10. Es importante ser honestos con nosotros mismos para tener una buena conciencia.

11. Binigyan ni Jose ng pera si Bob.

12. Inisip ko na lang na hindi sila worth it para hindi ako mag-inis.

13. Dalam Islam, kelahiran bayi yang baru lahir diiringi dengan adzan dan takbir sebagai bentuk syukur kepada Allah SWT.

14. Napangiti na lang ako habang naka tingin ako sa kanya.

15. Football requires a lot of stamina, with players running and moving for extended periods of time without stopping.

16. Mahalaga ang regular na pagsisipilyo at paggamit ng dental floss upang maiwasan ang mga sakit sa bibig.

17. Tinutukoy niya ang tarangkahan ng opisina kung saan sila magkikita.

18. Ito ang tanging paraan para mayakap ka

19. Ikinagagalak ng buong komunidad ang pagbubukas ng bagong paaralan sa kanilang lugar.

20. It takes one to know one

21. Inalis ko yung pagkakayakap niya sa akin. At umupo sa sofa.

22. Agad na kumalat ang balita na may dala si Ana na pagkain, kaya sumugod sila sa bahay ni Aling Rosa.

23. Eine schwere Last auf dem Gewissen kann uns belasten und unser Wohlbefinden beeinträchtigen.

24. May kanya-kanyang bayani ang bawat panahon.

25. "Every dog has its day."

26. Gumagawa ng tinapay si Tito Mark sa kusina.

27. Inakalang imposible ang kanyang pangarap, pero naabot niya ito.

28. Kahit hindi siya lumingon, para na niyang nakita si Ogor.

29. Aaissh! biglang upo si Maico pagka-maktol.

30. The depth of grief felt after losing a loved one is immeasurable.

31. Il fait beau aujourd'hui, n'est-ce pas?

32. Automation and artificial intelligence have further improved transportation, making it safer and more efficient

33. Ang digmaan ay maaaring magdulot ng mga trauma at sakit sa mga biktima at kalahok.

34. Wala na akong natitirang pera, umaasa na lang ako sa ayuda.

35. Pakibigay ng lakas ng loob ang bawat isa upang magpatuloy sa buhay.

36. Matagal ko nang nararamdaman ang mga ito, kaya sana pwede ba kita ligawan?

37. Nagtatrabaho ako sa Mimosa Family Home.

38. Quitting smoking can be challenging and may require support from healthcare professionals, family, and friends.

39. Hockey requires a combination of physical and mental skills, including speed, agility, strength, and strategic thinking.

40. Motion kan også have positive mentale sundhedsmæssige fordele, såsom at reducere stress og forbedre humør og selvværd.

41. Sumimangot siya bigla. Hinde ako magpapapagod.. Pramis.

42. Ang pagkamatay ni Rizal ay naging simbolo ng paglaban sa kolonyalismo at pampulitikang opresyon sa Pilipinas.

43. You're stronger than this, pull yourself together and fight through the tough times.

44. Einstein's scientific work was heavily influenced by his philosophical and moral beliefs.

45. Dette er med til at sikre, at Danmark har en bæredygtig økonomi, der er i stand til at bevare ressourcerne til fremtidige generationer

46. Nagbigay siya ng magalang na pasasalamat sa tulong na ibinigay ng kanyang kaibigan.

47. Bago ang kasal, nagkaruon muna sila ng seremonya kung saan nagmamano siya bilang bahagi ng pamamamanhikan.

48. Malakas ang narinig niyang tawanan.

49. Esta comida está demasiado picante para mí.

50. "Malapit nang dumating ang bagyo, maghanda na kayo," ani ng weatherman sa telebisyon.

Recent Searches

associationhigh-definitioninantaycoatheheindustrykapebingodaramdamintuwangbabaebagcadenaprofessionallunasevolvedinternettvsactingnagtitindanakahigangrenombrehinawakanaktibistanakaririmarimsinapokpasyalanmagtataaskanikanilangunattendedkasintahanadgangtungkodpinisilisinuotemocionesbibilihospitalsupportbayaningnilayuanisuboreynaengland1960smonumentogreatlymaisipbuhoksalesmarangyangsilyaheartbreakcareernitoleadinginangbinasanagsipadyiptrademakasilongnakasahodseryosongdoktormenosarbejderprimerbroadcastumingitnuonsumusunomaymahabangrecordedkalikasanbasahanrhythmpumuntaipasokarawkartonthreetutorialskasinggandainspirasyonkwenta-kwentapaglalayagreserbasyonmagbibiyahemagasawangnanghihinanakapapasonghealthierressourcernemalezamarketplacesmaipantawid-gutomnapakamisteryosogalingpagpapatubopagka-maktolikinakagalitmovieskinamumuhianpalipat-lipatpinagsikapannaabutankabuntisanpupuntahanpahahanapmakapalaginilalabasluluwasmagbayadmakahiramnagtungomagkaibat-shirtpapanhikkumakantapagkabiglanaapektuhanibinilimasaksihanmahinangairportmatagpuangandahannakabawipagpanhiknapipilitanulapvidenskabpagbigyannagdaboggawinlaruinpinigilannagdadasalthanksgivingvideobalediktoryanengkantadanglumibotnakasakitsasakyancover,orkidyastagpiangnagbagogumigisingkangitannagsilapitpagguhitpundidokumampipaparusahannakatuonnakabluenahantadnatakotpinaulanangusalisaktancynthiatalagangmagalithinamaknilaospatakbongsugatangnanamande-latasakopmalasutlaretirarantesasahanmassachusettsairplanesdumilathanapinlivesbiyasnasankarapatanbutosikiptiyancocktailbumangonlayuanturonrobinhoodnatayomaglabapangako3hrs