Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Ang mga kasiyahan at salu-salo sa hapag-kainan ay nagdudulot ng kasiyahan sa bawat tahanan tuwing Chinese New Year.

2. At have håb om at gøre en forskel i verden kan føre til store bedrifter.

3. Ignorar nuestra conciencia puede llevar a sentimientos de arrepentimiento y remordimiento.

4. A portion of the company's profits is allocated for charitable activities every year.

5. Las vacaciones son una época para compartir regalos y mostrar gratitud.

6. Inalagaan niyang mabuti ang halaman at tinawag itong Pinang, Sa palipat-lipat sa bibig ng mga tao ang pinang ay naging pinya.

7. If you want to maintain good relationships, don't burn bridges with people unnecessarily.

8.

9. We have been walking for hours.

10. La tos puede ser un síntoma de neumonía.

11. We've been managing our expenses better, and so far so good.

12. Habang kaming mga naiwan ay paglalabanan at pag-aaralang tanggapin ang kirot ng pagkalungkot.

13. Nakita kita sa isang magasin.

14. Huwag kang pumasok sa klase!

15. Menciptakan keseimbangan antara pekerjaan, waktu luang, dan hubungan sosial membantu meningkatkan kebahagiaan.

16. Ilang taon ka tumira sa Saudi Arabia?

17. Controla las plagas y enfermedades

18. Magdoorbell ka na.

19. Nagpasama ang matanda sa bahay-bahay.

20. La decisión de la empresa produjo un gran impacto en la industria.

21. Menos kinse na para alas-dos.

22. Viruses can spread from person to person through direct contact, airborne transmission, or contaminated surfaces.

23. Andre helte er kendt for deres humanitære arbejde.

24. The concert raised funds for charitable causes, including education and healthcare.

25. Trump's rhetoric and communication style were often unconventional and garnered both passionate support and strong opposition.

26. We have been waiting for the train for an hour.

27. Gusto kong manood ng mga pambatang palabas.

28. At følge sine drømme kan føre til stor tilfredsstillelse og opfyldelse.

29. Dala ito marahil ng sumpa sa iyo ni Matesa.

30. La poesía de Whitman tiene una belleza sublime que transmite su amor por la naturaleza.

31. Comer saludable es una forma importante de cuidar tu cuerpo y mejorar tu calidad de vida.

32. Sampai jumpa nanti. - See you later.

33. Det er vigtigt at have gode handelsrelationer med andre lande, hvis man ønsker at eksportere succesfuldt.

34. Gumamit ang albularyo ng dahon ng bayabas upang linisin ang sugat ni Pedro.

35. Hindi ko maipaliwanag kung gaano kalalim ang inis ko sa mga taong nagtatapang-tapangan lang.

36. Ang lamig ng yelo.

37. Waring nag-aalinlangan siyang sagutin ang tanong ng guro.

38. The United States has a Bill of Rights, which is the first ten amendments to the Constitution and outlines individual rights and freedoms

39. Football is played with two teams of 11 players each, including one goalkeeper.

40. Tumayo yung lalaki tapos nakita niya ako.

41. Twitter chats are organized conversations on specific topics, usually held at designated times using a specific hashtag.

42. Kailan niya ginagawa ang minatamis?

43. Las redes sociales permiten a las personas conectarse y compartir información con amigos y familiares.

44.

45. Puwede kang magguhit ng mga larawan ng iyong pamilya at kaibigan upang ipakita ang pagmamahal sa kanila.

46. Ingatan mo ang cellphone na yan.

47. Napansin umano ng mga eksperto ang unti-unting pagtaas ng temperatura sa mundo.

48. El error en la presentación está llamando la atención del público.

49. Hindi siya nag-aral para sa pagsusulit, samakatuwid, bumagsak siya.

50. Kasama ang aking kabiyak, nalalampasan namin ang mga pagsubok at hamon na dumadaan sa amin.

Recent Searches

high-definitionlayuanmarmaingrenatosumisidosakamagta-trabahoflaviobigyanpeaceipaliwanagipinatawabstainingbutchforcesmaminapatingalamoneycompartenbrucekurbataitinaliginisinggovernmentreleasedbabylandlinecontinuedoperatedalagangmedinnovation1982monetizingsamaseenatingworkdaymaputicandidatepagiisipdaratingmapakalide-dekorasyonfuryayantelevisedpagkakamalinatalongbinilhanadgangspiritualnanaisinbusiness,filmkapagactionbibisitanaiiritangnalulungkottiniradornalasingbiologiikawalongpepenakakamitgalitnakatiraself-publishing,graduationpalapitkabuntisanrememberaffectreservationdeliciosamadulaspumapaligidkumaripasequipomangkukulammantikahalu-halotagtuyotnamumuloteffectsjamesbakanapapahintomakapaniwalaakongmanatilisulyapdevelopedarbejdsstyrkenagbasapawisnakataaskalawakanlinggongkatawanbornmuchasnagsuotpalitanfar-reachingnakakainbaldengpresleyyakapallefidelalapaapwriteeyapagtatakakumalmalumabaskamalayanitongboyetkasicoinbasekastilangtaun-taonjemikarnabalikinamataylovehumalakhakbalikmaliksilaybraripunongkahoynapaiyaklungsodmaipapautangisinusuotydelserdidingpinangalanannalalaropagbabasehanrenacentistataong-bayanmaibaangelakalikasannauntogna-suwayreceptorlikodfinalized,alanganpalamutihumanoskomunikasyonfacultyloryhinatidbungadrequierenbalik-tanawinisipbalitamaibabalikforskelmapuputinapilitangkumakapitisdamartestinatawagsukatinbilanginsinakopeffectbusymataraykanikanilangnakapasalandpasokritwalcommunitynagdaramdaminalissuccessfulnaghihirapibignaantigsilbingflyvemaskinerperoregularmenteidea:lasingerozoomdedication,deal