Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Ang mga anak-pawis ay kadalasang nakakaranas ng diskriminasyon sa lipunan.

2. Nasa labas ng bag ang telepono.

3. Wala kang sapat na pera para sa bakasyon? Kung gayon, ipagpaliban mo muna ito.

4. Comer una dieta equilibrada puede aumentar los niveles de energía y mejorar el estado de ánimo.

5. Isa sa kanyang kasamahan sa bilangguan ay si Tony

6. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

7. Gusto ko ang silid na may malaking bintana para maaliwalas ang pakiramdam.

8. A successful marriage often requires open communication and mutual respect between a husband and wife.

9. Dahil sa kagustuhang malaman ng mga kapatid ni Psyche ang hitsura ng asawa, tinanggal nila ang maskara nito at tumambad ang magandang mukha ni Cupid

10. Ang mailap na impormasyon ay kailangan pag-aralan ng mabuti upang maiwasan ang pagkakamali.

11. Marami ang botante sa aming lugar.

12. Sumali ako sa Filipino Students Association.

13. Ang pagiging maramot sa kaalaman ay nagiging hadlang sa tagumpay ng iba.

14. Si Tony ay nakapagtapos sa elementary at nagging balediktoryan

15. Ohne Fleiß kein Preis.

16. Sa kanyang pag-aaral ng sining, pinagmamasdan niya ang mga obra ng mga kilalang pintor.

17. Das Gewissen kann uns helfen, moralische und ethische Fragen zu beantworten.

18. Sweetness is an important factor in the culinary arts and food industry.

19. La realidad es que las cosas no siempre salen como uno espera.

20. Arbejdsgivere søger pålidelige og punktlige medarbejdere.

21. Hinintay lamang niya ang aking pagdating.

22. He is not driving to work today.

23. Ang aming angkan ay nagpapahalaga sa pagiging matapat sa mga relasyon.

24. Ngayon lang ako nag mahal ng ganito.

25. Women have often been the primary caregivers for children and elderly family members.

26. The new restaurant in town is absolutely worth trying.

27. Wag mong ibaba ang iyong facemask.

28. Environmental protection requires educating people about the importance of preserving natural resources and reducing waste.

29. Umiiyak siyang gumuglong sa basa at madulas na semento.

30. Me encanta pasar tiempo con mis amigos jugando al fútbol.

31. Ang saya ng Pinoy fiesta, lalo na kapag may parada at sayawan.

32. Nosotros nos disfrazamos y vamos a fiestas de Halloween durante las vacaciones.

33. Ang paggamit ng droga ay nagpapakita lamang ng kahinaan sa tao.

34. Ang mommy ko ay masipag.

35. Binabasa ng mga mag-aaral ang talambuhay ni Emilio Aguinaldo para mas maunawaan ang kasaysayan ng Pilipinas.

36. The acquired assets were key to the company's diversification strategy.

37. Sinimulan ko ng i-collect lahat ng bibilhin.

38. Maraming bagong laruan sina Justin at Andre.

39. Hindi dapat supilin ng mga magulang ang mga pangarap ng kanilang mga anak.

40. Bawal mag-drugs dahil ito ay nakakasama sa kalusugan at nakakadulot ng krimen.

41. Bless you.. tugon ko sa biglang pagbahing nya.

42. The acquired assets will help us expand our market share.

43. Bawal kumain sa loob ng silid-aralan upang mapanatili ang kalinisan ng paaralan.

44. Ginagamit ang salitang "umano" upang ipahiwatig na ang isang pahayag ay hindi pa tiyak at batay lamang sa sinasabing impormasyon mula sa ibang tao o ulat

45. Ang malawak na mga taniman ng mga prutas at gulay ay nagpapakita ng isang industriya na mayabong at umuunlad.

46. Peer-to-peer lending: You can lend money to individuals or small businesses through online platforms like Lending Club or Prosper

47. Ang marahas na paggamit ng lakas ay labag sa etika at pagkamamamayan.

48. Ang mga Pinoy ay likas na masipag at maabilidad sa anumang trabaho.

49. Sa pagdating ng suporta ng aking mga kaibigan, ang aking pag-aalala ay napawi.

50. Binili ni Rita ang damit sa tindahan.

Recent Searches

high-definitionlarongadangkapefeedback,sumabogpulubiusasumugodmuldevelopedaddressdi-kawasaeverythingeditneverentryipinalitiwananskirtnanghahapdiipapaputolsagasaannagtutulaknapapasayatravelercampaignsmalayapanunuksonag-poutnagpuyosiwinasiwaskalabawkumidlatkinalakihanprobinsiyaguidewatawatnangangakokayabanganpag-isipanalituntunindahilmaibibigayalapaapmusicalessesamenaabotestasyonlumipadlakadmalayongmadamingmagkakapatidsectionsnabigaymakalinglumbayexperience,dipangkasoyyoutubehulisundaecashbingomininimizeosakapinahalatapalagibossmaaripakelamitinalimayocomienzanipagamotmag-aamajailhouseataquesrolecomunesinternetkaraokekomunidadryaninteriorviewincreasedflashgapdumaramistringkampeonmahihirapnawalangpagkapasokinilalabaseskuwelaaanhinmakapagsabinakasandignagpaiyakpagkahapoumiiyakmagkaibanaglalakadpagpapakilalanakapapasongmakapangyarihangpagpapakalatkasalukuyanginugunitanag-eehersisyokusineromaipagmamalakingtanggalinmagkamalikuwadernonanlalamigtatagalkabuntisannapanoodnaibibigaynakuhapagmamanehomalakibusiness:bigpartsmakapagempakenakatitignapuyatsinusuklalyanmagpapigilisadesisyonanbalahibotinaynaapektuhanseguridadkinalilibinganistasyonmilyongtamadaffectkumananmasaganangpumulottinahaktuktoktinungopinalalayasnakabluemaghahabipuntahanbowlumigtadsinundangpermitebinitiwanhinalungkatcynthiapapayatagpianginiresetabintananakisakaypagdiriwangcombatirlas,bayadkampanapwestoampliasakopsisentamawalaumabotmaghapongpanatagretirarkumainnatalokonsyertopagsusulitnagniningningmadalinggym1960stiyancocktaillayuaninfusioneshinintayomfattendelupain3hrspinoygloriajuanito