Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Durante el invierno, se pueden ver las auroras boreales en algunas partes del mundo.

2. Kapag nawawala ang susi, sinasalat niya ang bawat bulsa.

3. Sa panahon ng pandemya, mas marami ang nangangailangan ng bukas palad na pagtulong mula sa atin.

4. Sa muling pagtataas ng tungkod ng matanda, lalong dumagundong ang mga kulog at tumalim ang mga kidlat.

5. Lingid sa kaalaman ng prinsesa gayundin ang nararamdaman ng bagong kakilala sa kanya.

6. Pakibigay sa tindera ang tamang bayad para hindi siya malugi.

7. Sa sarili, nausal niyang sana'y huwag siya ang maging paksa ng paghaharutan at pagkakatuwaan ng mga agwador.

8. Nagmadali kaming maglakad papalapit kay Athena at Lucas

9. All is fair in love and war.

10. The festival showcases a variety of performers, from musicians to dancers.

11. Mi temperatura es alta. (My temperature is high.)

12. Napaka presko ng hangin sa dagat.

13. Kanina ka pa? tanong ni Aya sa akin.

14. Ayaw ng kaibigan ko ang mainit na panahon.

15. Mahalaga ang pag-aaral sa talambuhay ni Teresa Magbanua upang maipakita ang papel ng kababaihan sa himagsikan.

16.

17. Les employeurs peuvent promouvoir la diversité et l'inclusion sur le lieu de travail pour créer un environnement de travail équitable pour tous.

18. Lazada's mobile app is popular among customers, with over 70 million downloads.

19. Alors que certaines personnes apprécient le jeu comme passe-temps ou forme de divertissement, il peut également conduire à la dépendance et à des problèmes financiers.

20. Napakaganda ng disenyo ng kubyertos sa restaurant na ito.

21. Påskeferien giver også mange mennesker mulighed for at rejse og udforske nye steder.

22. Nagpatingin ang bata sa albularyo matapos siyang makagat ng aso.

23. Bigla, ubos-lakas at nag-uumiri siyang umigtad.

24. Isinilang si Apolinario Mabini noong ika-23 ng Hulyo, 1864.

25. Hi Jace! Mukhang malakas na tayo ah! biro ko sa kanya.

26. Min erfaring inden for dette område har været meget givende.

27. Pinangaralan nila si Tony kung gaano kahalaga ang isang ama

28. He's always telling tall tales, so take his stories with a grain of salt.

29. The police were searching for the culprit behind the rash of robberies in the area.

30. They have studied English for five years.

31. Naramdam ng pagkaawa si Mang Kandoy kaya't agad niyang binato ng isang piraso ng matigas na kahoy ang tigre upang malihis ang atensyon nito sa usa.

32. Pinagsulat si Jayson ng pangungusap sa pisara.

33. Las labradoras son conocidas por su energía y su amor por el agua.

34. O sige na nga, diba magkababata kayo ni Lory?

35. Instagram Stories is a feature that lets users share temporary photos and videos that disappear after 24 hours.

36. Ang kanyang mga salita ay nagbabaga ng inspirasyon sa mga nakikinig.

37. Kapag bukas palad ka, mas maraming taong magmamahal at magtitiwala sa iyo.

38. How I wonder what you are.

39. Saan itinatag ang La Liga Filipina?

40. The team's success and popularity have made the Lakers one of the most valuable sports franchises in the world.

41. This has led to a rise in remote work and a shift towards a more flexible, digital economy

42. Bigla nya akong hinigit sa kwelyo, Anong sinabi mo?

43. Sa bawat hampas ng alon, tila naririnig ko ang panaghoy ng mga nawawala sa dagat.

44. Kumain na tayo ng tanghalian.

45. "Tapos na ang laban, wala nang dapat pang pag-awayan," ani ng punong barangay.

46. Nanatili siya sa isang mataas na puno at nagmasid-masid ulit muna ito at inantay kung sino ang mukhang nananalo.

47. Ang mga firefighter nagsisilbi upang protektahan ang mga tao mula sa mga sunog.

48. Si Aling Juana ang tagalaba ng pamilya.

49. Effective representatives possess strong communication, leadership, and negotiation skills to effectively represent their constituents' interests.

50. Minsan, nagkakaroon ng agam-agam sa isip ng mga magulang kapag nag-aalala sila sa kinabukasan ng kanilang mga anak.

Recent Searches

panindangdissemaibalikltoaksidentebecamehigh-definitionbulakcarmenimagesmakakayainformedtelangsaanmagandadollyahitdinalawcontestmasdanisugaseesantolingidclientsweddingpinyaspentsufferasimaabotvalleysalarinlegislationsinagotklasecoalfarmkalaunanpatuloytangingtablehousetoyaalisthroattobaccotinderaandresnagrereklamokadaratingdiyabetispag-aalalainstrumentalagaw-buhayrightscancermaligoalinpunung-punoisangmatinditambayanniyangpinilitginaganoonpagkatakotiniibigrepublicanhimutokpagenaabotnakakainmalawakgamitinbroadikinagagalakduriannumbernagtatrabaholeadtanongbarangaynagpapaigibmagpakasalkontingtelevisionitinuloscynthiasapatosdecisionspinagpatuloytinatawagobservererisinulatmakapangyarihangnagliliyabnapakatalinorenombrengingisi-ngisingnakauponakakunot-noongkasalukuyandahan-dahannananalolumikhanagsunuranbiologidumagundongturismokapangyarihandapit-haponlabing-siyamnagtuturoeskwelahanmakangitipagpapasannakahigangtatawagalas-diyesnagtatanongmagpaniwalanaiwantanggalinmalapalasyonandayanaglaholumakikinalilibingannaapektuhantemparaturapinapalonagpabotgumagamitnagtalagabulaklakpambahaypaglisanpagkagustoaktibistahouseholdsdulohaponhulihanprincipalesnagbabalaaga-agapeksmantinataluntonmakapalnatuwakondisyonkinumutanumiisodre-reviewpagbabayadnaglulutomakawalamagsugalitinatapatmaibibigaykamalianincitamenterbusiness:mahahawagagamitbayadkastilangumagangmagisippaglingonnagbentapicturesmagawasinisirarodonagumuhittog,telecomunicacionesinaabotnatanongtraditionalunosbiglaanmandirigmangpagsidlankanayanggumisingmaranasanincrediblepakibigaykastilabenefitsgawingibabawgalaankalaromarangalisinalaysaymaibigay