Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Napahinto kami sa pag lalakad nung nakatapat na namin sila.

2. Bukas na pala ang araw ng kalayaan.

3. Television is a medium that has become a staple in most households around the world

4. Ang pagtanggi sa mga paniniwala at opinyon na hindi pabor sa sarili ay nagpapakita ng pagiging bulag sa katotohanan.

5. Bumili ako ng sapatos sa Shopee.

6. Aku benar-benar sayang dengan hewan peliharaanku. (I really love my pets.)

7. ¿Te gusta la comida picante o prefieres algo más suave?

8. Ang droga ay hindi nagbibigay ng solusyon, kundi dagdag na problema pa.

9. Ow, sorry nagising ata kita. aniya.

10. He was advised to avoid contact with people who had pneumonia to reduce his risk of infection.

11. kami kumikilos mula sa kinatatayuan namin.

12. Maaari ring magdulot ng agam-agam ang pagbabago sa buhay tulad ng paglipat sa ibang lugar o pagbabago ng trabaho.

13. Naglipana ang mga bulaklak sa hardin dahil sa maayos na pag-aalaga.

14. Ang laki ng gagamba.

15. Kung hindi ngayon, kailan pa ang tamang panahon?

16. Nagbigayan kami ng mga regalo noong Pasko.

17. There are a lot of amazing destinations to explore around the world.

18. Oo malungkot din ako. Mamimiss kita.

19. Masakit mang tanggapin, sa pamilya pa rin ang tatak ng iyong pagkatao.

20. How I wonder what you are.

21. Forældre har ansvaret for at give deres børn en tryg og sund opvækst.

22. The professor delivered a series of lectures on the subject of neuroscience.

23. Mag-aaral ako ngayon, datapwat sa hapon ay pupunta ako sa doktor.

24. Sa pulong ng mga mag-aaral, ipinahayag nila ang kanilang mga mungkahi upang mapabuti ang pasilidad ng paaralan.

25. Inakalang madaling matatapos ang proyekto, ngunit maraming komplikasyon ang dumating.

26. La paciencia es la clave para conseguir lo que deseamos.

27. No dejes para mañana lo que puedas hacer hoy. - Don't put off until tomorrow what you can do today.

28. Napapansin niya na madalas siyang naglalakad patungo sa kusina nang may isang bagay na gustong gawin, pero pagdating doon, bigla niyang nalilimutan kung ano iyon.

29. Wala siyang sapat na budget, samakatuwid, hindi niya mabibili ang gustong cellphone.

30. La conciencia nos recuerda nuestros valores y nos ayuda a mantenernos fieles a ellos.

31. Los médicos y enfermeras estarán presentes durante el parto para ayudar a la madre y al bebé a pasar por el proceso.

32. Ibinigay ng kumpanya ang malaking kawalan sa kanilang kita upang masiguro ang kaligtasan ng kanilang mga empleyado.

33. The company's stock market value has soared in recent years, making Tesla one of the most valuable automakers in the world.

34. Isang araw, habang nangangahoy si Mang Kandoy, nakakita ito ng isang kweba sa gitna ng kagubatan.

35. Hinanap nila ang magandang babae upang pasalamatan ngunit wala na ito.

36. Nag-aalinlangan ako sa aking desisyon dahil sa aking mga agam-agam tungkol sa magiging epekto nito sa aking pamilya.

37. They do yoga in the park.

38. They have been creating art together for hours.

39. Napuyat ako kagabi dahil sa panonood ng k-drama.

40. Ang panaghoy ng bayan ay naging inspirasyon upang magkaisa para sa pagbabago.

41. Cancer is a leading cause of death worldwide, and millions of people are diagnosed with cancer each year.

42. He has been working on the computer for hours.

43. Malapit na ang araw ng kalayaan.

44. Happy birthday sa iyo!

45. Kung anong puno, siya ang bunga.

46. Nagtayo ng scholarship fund si Carlos Yulo para sa mga batang gustong mag-aral ng gymnastics.

47. My sister gave me a thoughtful birthday card.

48. Buwal ang lahat ng baldeng nalalabi sa pila.

49. In theater, "break a leg" is a way of wishing someone good luck without actually saying it.

50. Kasintahan ka ba nitong aking apo? tanong ni Lola.

Recent Searches

high-definitionlaybrariailmentskoronalamangsemillashaymaestromalayomagbayadstevematangallottedtogethermalaki-lakiblendmapakalimentaleveningkinakaliglignagbababakitang-kitanag-poutbuung-buohiligjanedaddypartbornoncehumanstoohalagaroughbukassamahanproductividadmessagenapilinglibertyfullpakikipagtagpomahuhusaytutoringrelievedsnahighrevolucionadokapangyarihandiyosabukodumuulannagtuturoenvironmentpilipinobulsapalamutihawakkidlateffectspinamumunuantalinosanganagpapaigibpalapitmaskarapabili1980estadoshabitkantatinulunganmumurarockpagkakalapatsweetkumiloslilimmediumkailansawapananimnaliwanaganbilaopinalakingganagumantibakunamagka-aponamnaminpadredaanggodhintayinpaabirthdaytiyapatiencepinagpalaluanmatiwasayslaveinitmasamapinaulananfriendssyangmasaganangbayadnapilipracticeskamakalawadenguronagingmanamis-namishelptunayculturanalalaglagberkeleynagsisigawnaguguluhangpaki-translateaanhinpamilyangmaipapamanalarrypagkataposuusapantatagalpronounnararamdamanmagbibiladfilipinanakikitangnyadyipniiniindakapitbahaynoodayshinalungkatrespektivede-latasikatmaayospinilithveralaypatunayannakatinginfavorheheradiolaryngitisalispamamagitanlordsalamatmalayangprogramming10001876tuwangotraswaysdoonanakpobrengforskel,pasukaninternalref1982nakagagamotmedya-agwaginugunitakadalagahangpunung-punokayang-kayangeventosgagawinmiraturismomasayahinlumikhaartistashubad-baronakakatawanakagalawkwenta-kwentaeskwelahanpagtiisanlivenakuhahiwanakatulogmakakakaennagpabotparehong