Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. La lavanda es una hierba que se utiliza en aromaterapia debido a su efecto relajante.

2. Nakikihukay siya ng mga halamang ugat at namumulot ng tirang pagkain.

3. Pakain na ako nang dumating ang kaibigan ko.

4. Ang mga resort sa tabing-karagatan ay puno ng mga turista tuwing summer.

5. His presidency was marked by controversy and a polarizing political climate.

6. Lalong nag-iyakan ang dalawang bata.

7. Nag-usap kami kamakalawa ng tanghali.

8. En tung samvittighed kan nogle gange være et tegn på, at vi har brug for at revidere vores adfærd eller beslutninger.

9. Binentahan ni Mang Jose ng karne si Katie.

10. Amazon's customer service is known for being responsive and helpful.

11. Gusto naming makita uli si Baby Janna eh. si Maico.

12. Paano ako pupunta sa Intramuros?

13. Transkønnede personer er mennesker, der føler sig som det modsatte køn af det, de blev tildelt ved fødslen.

14. Il fait beau aujourd'hui, n'est-ce pas?

15. Ang aking kaulayaw sa kanto ay nakatulong sa akin sa paghahanap ng trabaho.

16. The first microscope was invented in the late 16th century by Dutch scientist Antonie van Leeuwenhoek.

17. Kailan at saan po kayo ipinanganak?

18.

19. Elektroniske apparater kan hjælpe med at forbedre præcision og nøjagtighed af forskellige opgaver.

20. Sa araw ng pamamamanhikan, dala-dala ng pamilya ng lalaki ang mga handog para sa pamilya ng babae.

21. Natakot umano ang mga estudyante nang marinig ang kwento tungkol sa multo sa eskwelahan.

22. The chef is cooking in the restaurant kitchen.

23. Les personnes âgées peuvent bénéficier d'un régime alimentaire équilibré pour maintenir leur santé.

24. The task of organizing the event was quite hefty, but we managed to pull it off.

25. Salatin mo ang mga butones ng remote upang mahanap ang tamang pindutan.

26. Sa kabila ng mahigpit na bantay, nangahas silang tumakas mula sa kampo.

27. Dwyane Wade was a key player in the Miami Heat's championship runs and known for his clutch performances.

28. Les thérapies alternatives telles que l'acupuncture et la méditation peuvent aider à réduire le stress et améliorer la santé mentale.

29. Mataas sa calcium ang gatas at keso.

30. Dali-daling umalis ang binata patungo sa palasyo.

31. Nay, ikaw na lang magsaing.

32. Maganda ang pakiramdam kapag mayroon kang kaulayaw na makakasama sa buhay.

33. Simula nung gabing iyon ay bumalik na ang sigla ni Nicolas at nagsimula na siyang manilbihan sa Panginoon

34. Napakainit ngayon kaya't kinailangan kong nagiigib ng malamig na tubig para sa sarili ko.

35. El Día de San Valentín es una festividad muy popular en muchos países.

36. Naging masaya ang aking buhay dahil sa aking mga kaulayaw.

37. Ang malakas na pagsabog ng bulkan ay binulabog ang buong komunidad.

38. Den danske kirke fejrer påsken med flere forskellige ceremonier i løbet af Holy Week.

39. Aalis na ko mamaya papuntang korea.

40. Sige na, sabihin mo na yung mga gusto mong sabihin sa akin.

41. La tormenta produjo daños significativos en la infraestructura de la ciudad.

42. At have en træningsmakker eller træningsgruppe kan hjælpe med at øge motivationen og fastholde en regelmæssig træningsrutine.

43.

44. There were a lot of boxes to unpack after the move.

45. Ano ang pinag-aaralan ni Cora?

46. This allows students to take classes from anywhere, and it also allows for the creation of specialized programs and courses that would not be possible in a traditional classroom setting

47. Gaano katagal po ba papuntang palengke?

48. Taga-Ochando, New Washington ako.

49. Ang mga Pinoy ay may kakaibang hilig sa basketball at volleyball.

50. He was selected as the number one overall pick in the 2003 NBA Draft by the Cleveland Cavaliers.

Recent Searches

lumilipadhigh-definitionpanginoonmakatulogjoshuakumalmalumikhapresidentengayomagkasabaymag-aaralnanghurtigerenucleariwanrenacentistakisapmatawalahumingimagdadapit-haponsectionsresultmulighederraiseetosinonaiinisbilihintelebisyonannaganungloriavarietybisitatitaattorneynakikini-kinitapakistanbibisitanagtrabahotalagadumilimmulanobodyarghkasamaangpaglalaitbwahahahahahapalangmaskaranearlangkaykagandahanmamanhikanfeelpiyanoyamanmangingisdangkommunikerertopicnakakadalawmiramejoinastatamadkagabipangettinanggalsabadnammaibigaypaglalabalipatpasaheh-hoynabiawangnakakatandanangampanyadyipgumagamitentrancepositibopagkahapolikesbatoknaglulutokargahanbroadinantaymahiyanakapapasongnatagalankainitankalongnagkabungailihimanimouwakhinigitpetsamakahingipanitikan,edsanabigkastekabumabaahasvispasalamatanbinataksinumangtunayhinabibundokunconventionalexhaustedlibrenangangaralnagbabaladisposalibigfertilizergawingsamalargerbaulkahaponhelpguidanceaidpeterpagbahingsparksharingwriting,breakmakaratinginimbitachadboyfriendubodricapasensiyanakahainsinaliksikfiverrpaghabakasalnakahantadmananaige-booksrambutanpokersweetempresaspublicationtenidooktubreobstaclesnakakaanimlondondumagundongbabesvitaminnameafternabalitaaninyokapeteryabayangnuevoslumiwanagpalabuy-laboykaaya-ayanglittlepalasyomagdoorbellkwartobutilnageespadahannaglakadplannakakasamapeksmanrobinhoodnatatanawpagdukwangganyansimbahahiligaayusinsummer10thmagpa-picturebinilhanbalotiniibigmaliniskuripotgagamit