Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

38 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

21. Stress can be a contributing factor to high blood pressure and should be managed effectively.

22. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

23. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

24. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

25. The doctor measured his blood pressure and diagnosed him with high blood pressure.

26. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

27. The king's court is the official gathering place for his advisors and high-ranking officials.

28. The laptop's hefty price tag reflected its powerful specifications and high-end features.

29. The medication helped to lower her high blood pressure and prevent complications.

30. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

31. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

32. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

33. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

34. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

35. The patient's family history of high blood pressure increased his risk of developing the condition.

36. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

37. Up above the world so high

38. Up above the world so high,

Random Sentences

1. At noon, higit kailanman, naging hamak sila sa pagtingin ng lahat.

2. Children's safety scissors have rounded tips to prevent accidental injuries.

3. Samantala sa pamumuhay sa probinsya, natutunan niyang mas ma-appreciate ang kagandahan ng kalikasan.

4. Nandoon lamang pala si Maria sa library.

5. Umokay ang result ng pagsusulit ni Jayson matapos itong magsunog ng kilay.

6. The cough syrup helped to alleviate the symptoms of pneumonia.

7. Meal planning and preparation in advance can help maintain a healthy diet.

8. The telephone has undergone many changes and improvements since its invention

9. Ang dalawang isinumpa ay namuhay sa kakahuyan.

10. Maraming tao ang nagpapanggap na bukas palad upang makuha ang gusto nila, kaya kailangan nating maging maingat.

11. The exhibit features a variety of artwork, from paintings to sculptures.

12. Mabuti naman,Salamat!

13. Wala nang iba pang mas mahalaga.

14. Some businesses have started using TikTok as a marketing tool to reach younger audiences.

15. I found a great recipe on a cooking website that I can't wait to try.

16. The website's search function is very effective, making it easy to find the information you need.

17. Malaya na ang ibon sa hawla.

18. They are not hiking in the mountains today.

19. Nag-aral kami sa library kagabi.

20. Electric cars are part of a larger movement toward sustainable transportation, which includes public transportation, biking, and walking, to reduce the environmental impacts of transportation.

21. Maiba ako Ikaw, saan ka magpa-Pasko?

22. Magkakasama ang mga damit nila nina Kano, Boyet at Diding.

23. Kapag tag-araw ay malaki-laki rin ang kinikita ng mga agwador.

24. Napakagaling nyang mag drowing.

25. Hindi ako sang-ayon sa mga kuro-kuro ng ilang mga pulitiko.

26. Sa mga gubat ng Mindanao, may mga punong-kahoy na may napakalaking kahoy at tinatawag itong "Lauan".

27. Ilang oras silang nagmartsa?

28. Sa Chinese New Year, ang mga pamilya ay nagtitipon upang magsalu-salo at magbigayan ng mga regalo.

29. Después de lavar la ropa, la puse a secar al sol.

30. Las suturas se utilizan para cerrar heridas grandes o profundas.

31. Bukas ay mamamanhikan na kami sa inyo.

32. Vaccines are available for some viruses, such as the flu and HPV, to help prevent infection.

33. Si Anna ay maganda.

34. Bigla niyang naalala si Helena, napatigil siya sa kanyang pag-iyak at napangiti na lang ang binata.

35. Alas-diyes kinse na ng umaga.

36. Kanser ang ikinamatay ng asawa niya.

37. Dapat kong bilhan ng regalo si Maria.

38. Effective communication and problem-solving skills can help prevent or resolve situations that lead to frustration.

39. Nous avons invité tous nos amis et notre famille à notre mariage.

40. Let the cat out of the bag

41. Nakita niya ang isang magandang babae sa kaniyang harapan.

42. S-sorry. mahinang sabi ni Mica.

43. Twitter has millions of active users worldwide, making it a powerful tool for real-time news, information, and social networking.

44. Viruses can be used as vectors to deliver genetic material into cells, which can be used to treat genetic disorders.

45. Mag de-dekorasyon kami mamaya para sa kanyang 18th birthday.

46. Sa mga nagdaang taon, yumabong ang mga proyekto para sa kalikasan at kabuhayan ng mga tao.

47. L'inflation peut affecter la valeur de l'argent au fil du temps.

48. Dette skyldes, at den offentlige regulering sikrer, at der er en vis grad af social retfærdighed i økonomien, mens den frie markedsøkonomi sikrer, at der er incitamenter til at skabe vækst og innovation

49. Ang bayanihan ay nagpapakita ng kahalagahan ng pagtutulungan at pagkakaisa sa pagharap sa mga suliranin.

50. Bagsak ang ekonomiya ng Pilipinas matapos ang nangyaring kaguluhan.

Recent Searches

high-definitionnag-aalaypalabassamakatuwidyorksongmapalampashealthartistsbrainlymeetnapakabilistayotinuturopagodnaglaoncultivarlisteningagwadornabiglanagsilabasanmaingataffiliateconectadosloryatingthoughtsibinigaymarkaffectattackpanalanginsakenpositionersalapipatongnapatigilvedgalawcomplexregalomalusognagniningningsumasambatumubopagdiriwangdoesrhythmmilyongfreedomsmagazinesscottishdecisionsmahinangtabingproduktivitetpagpalit1928materyalesfonoslargermakaangalsaritabuwenasmaramdamanipaghandainuunahanbritishkaininespigaspeaceretirarmayabongnamamanghacommunicationsbaclarankanilacapacidadeschoiribotoantibioticsbigongtelevisionnagbabababuslopamilyadumatingtapatdriverkasamahanpinalalayaskonsyertoskyldespagkabiglasakitniyankasihintuturounapagtawabansaitongsangkapcarsminamadalimanamis-namisnagkikitabalitailocoscigaretteventastonehamtomorrowkara-karakaprivatenagpasensiyamanatilitamaitokahaponkatotohanankanginaputiprosesomakuhangnakapuntananahimikdeterminasyonplayshabangnationalgumandasiyentoskalayuanpadalasmeaningmbricosmalamigsamahanbotodigitalreplacedsaydailykasuutancarlodividespinagalitannakaupomannakataasparinaanhinsupremeumilingmultonakabaonmeanherundersumakayimikcreatedgayunpamanpocapondoyumaongunitgenerateunfortunatelyenviardentistalumbaywaaasalabiliboksingthesetinapaymatandangmagkakailapag-itimtamaanpagkabatautilizartipmaarawitinaponbaskethinanaprobertgagawapulisbokinorderumaagosaspirationistasyonlawatumubongsumusuno