Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. The objective of football is to score goals by kicking the ball into the opposing team's net.

2. Gracias por hacer posible este maravilloso momento.

3. The culprit who stole the purse was caught on camera and identified by the victim.

4. Dahil sa sobrang init, naglipana ang mga puting ulap sa kalangitan.

5. Ano ang pinapanood mo sa telebisyon?

6. It is a common phenomenon experienced by individuals who feel a strong emotional pull towards parenthood and starting a family.

7. Pumasok ka na lang sa kwarto. Susunod na lang ako..

8. Some individuals may choose to address their baby fever by actively trying to conceive, while others may explore alternative paths to parenthood, such as adoption or fostering.

9. Maarte siya sa kanyang hitsura kaya lagi siyang nakabihis ng maganda.

10. Nang matuklasan ng binatilyong apo na siya ay isang pangit na hayop na, kumarimot siya patakas sa baranggay.

11. Hindi mo aakalaing maarte siya sa mga damit dahil hindi naman ito halata.

12. Receiving recognition for hard work can create a sense of euphoria and pride.

13. Gusto kong malaman mo na may ganitong pakiramdam ako, kaya sana pwede ba kita ligawan?

14. Ang kaibuturan ng kanyang pagkatao ay hindi mo agad makikita.

15. Kailan siya nagtapos ng high school

16. En af de vigtigste drivkræfter i den danske økonomi er eksporten

17. I baked a delicious chocolate cake for my friend's birthday.

18. Bawal mag-abuso ng kapangyarihan dahil ito ay isang krimen.

19. Narinig ko ang lagaslas ng tubig mula sa shower.

20. Los agricultores merecen ser valorados y respetados por su trabajo duro y su contribución a la sociedad.

21. Hiram na kasuotan ang ginamit niya para sa theme party.

22. Magandang umaga naman, Pedro.

23. Nasisilaw siya sa araw.

24. Ang pagkakaroon ng mga programa at kampanya sa paglaban sa droga ay mahalaga upang maiwasan ang pagkalat nito sa lipunan.

25. Ani niya, wala nang makakatalo sa kanyang kakayanan.

26. Sleeping Beauty is a princess cursed to sleep for a hundred years until true love's kiss awakens her.

27.

28. Ang paglapastangan sa mga pampublikong lingkod ay dapat maparusahan nang naaayon sa batas.

29. Sa bawat bagong taon, may ritwal silang ginagawa upang magdala ng suwerte at kasaganaan sa buong pamilya.

30. Stephen Curry revolutionized the game with his exceptional three-point shooting ability.

31. Si Anna ay maganda.

32. Pumila sa cashier ang mga mamimili nang limahan.

33. Sa isang pagamutan ng pambansang bilangguan sa Muntinlupa ay makikita ang apat na lalaking may kanya-kanyang karamdaman

34. Nous avons réservé une salle de réception pour la célébration.

35. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

36. Si Maria ay nagpasya nang lumayo mula sa kanyang asawa dahil sa patuloy na pisikal na abuso.

37. Durante las vacaciones de Semana Santa, asistimos a procesiones religiosas.

38. May naisip lang kasi ako. sabi niya.

39. Ayaw niya ng maarteng palabas kaya lagi siyang nakatago sa kanyang kwarto.

40. Ang tunay na kaibigan ay maasahan sa oras ng kagipitan.

41. The Statue of Liberty in New York is an iconic wonder symbolizing freedom and democracy.

42. The restaurant was full, and therefore we had to wait for a table.

43. Dadalaw ako kay Lola Sela bukas.

44. Nakita ko ang mga kapatid ko noong pasko.

45. Keep in mind that making money online takes time, effort, and patience

46. With the Miami Heat, LeBron formed a formidable trio known as the "Big Three" alongside Dwyane Wade and Chris Bosh.

47. Ang bahay ni Lola ay palaging mabango dahil sa mga bulaklak na nasa hardin.

48. Kasya kay Suzette ang blusang na ito.

49. Gaano kalaki ang bahay ni Erap?

50. En boca cerrada no entran moscas. - Silence is golden.

Recent Searches

high-definitionedsapalapitalexanderipapaputolscottishjoseroonbumahapinalutobusyangdisyempretelangyumanigsweetorugaingatanultimatelyipatuloykalayaanmakabilinag-aagawantag-ulanvideoriskimaginationfakerhythmginawaranbusjuicengpuntaeveningrichsangkalansigamingfourconditioningpossiblemichaelnakaka-bwisitagaw-buhaypanunuksolumipadmaalwangsourceusingcomunicarsecertaindatingsumunodsunud-sunodmagpakaramituminginlindoltuladtripbukodakindagat-dagatanclockmontrealsourcesdivisoriama-buhayhudyatpasanginternals-sorryevilkabosespaaralanmaglalabing-animmaliligokatulongalingkakataposbilibidbabarememberipinalutoremotesamaamountpowerskinakitaantelebisyonhouseholdsmahihirapnagmadalingpagtatanongkapamilyananahimikpapanigmagpaniwalanagpapaigibtinatawagikinakagalitsang-ayoniloilopioneermahuhusayumiinommorningtahimiklabinsiyamnagsuotpacienciakinasisindakankumakantagayundinpunongkahoybiyernesplantasmangyarinapahintoisinuottaxikanginanoonglungsodtienenkatolisismomagawapakukuluanpumulotmatutulogkinakainisinaranaabot1970svictoriaspecificawang-awapampagandaalagahinampasbibilhinbasketballkusinakindergartenpasalamatanmatulisyariaaisshanagigisinglabing-siyamburmahiningigoshlumulusobhuwebeschoipinyamagdapierfiabranchduonkutoexameventsbobobakitmodernmayomarchtenitaktherapytodayabenebelievedplayedmaliitabstainingnagreplysaringpeterpapuntaendenforcing4thschedulerepresentativecurrentbetweenkapit-bahayconvertingtwokanyapagkakatuwaanenfermedades,energy-coalalikabukinnagtuturonalalabimakakawawa