Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Mie goreng adalah mie yang digoreng dengan bumbu-bumbu khas Indonesia hingga terasa gurih dan pedas.

2. Påskepyntning med farverige blomster og påskeharer er en tradition i mange danske hjem.

3. Pahiram ng iyong cellphone, nawala ang aking battery.

4. Di ko inakalang sisikat ka.

5. The Discover feature on Instagram suggests accounts and content based on a user's interests and interactions.

6. He is widely considered to be one of the most important figures in the history of rock and roll and has had a lasting impact on American culture

7. Kebahagiaan dapat ditemukan dalam hubungan yang sehat dan penuh cinta dengan keluarga, teman, dan pasangan.

8. Instagram Stories is a feature that lets users share temporary photos and videos that disappear after 24 hours.

9. Ang mga anak-pawis ay nangangailangan ng mas mataas na antas ng edukasyon upang umangat sa kanilang kalagayan.

10. Tumango lang ako at ngumiwi, Oo eh, hindi kasi ako sanay.

11. Hakeem Olajuwon was a dominant center and one of the best shot-blockers in NBA history.

12. Kailangan kong harapin ang aking mga agam-agam upang hindi ako magpakita ng kahinaan.

13. Grabe naman ang lockdown na yan ilang buwan na.

14. The sun is setting in the sky.

15. Nagsmile siya sa akin at ipinikit niya ulit yung mata niya.

16. Tumulo ang laway niya nang nakita niya ang pinaka-masarap na kakanin na inihain sa kanya.

17. Necesitamos esperar un poco más antes de cosechar las calabazas del jardín.

18. At habang lumalaki na nga ang bata ay unti-unti itong naging bihasa sa paghahabi ng mga tela.

19. La música clásica tiene una belleza sublime que trasciende el tiempo.

20. Pahiram ng iyong sasakyan, wala akong ibang masasakyan pauwi.

21. Ngayon ka lang makakakaen dito?

22. Gusto ko ang silid na may malaking bintana para maaliwalas ang pakiramdam.

23. Pumasok po kayo sa loob ng bahay.

24. Mahirap makipag-usap sa mga taong mailap at misteryoso.

25. He drives a car to work.

26. La menta es una hierba refrescante que se utiliza en bebidas y postres.

27. Hindi naman yan iniisip eh! Pinapakiramdaman!

28. Napansin umano ng mga eksperto ang unti-unting pagtaas ng temperatura sa mundo.

29. Kumanan po kayo sa Masaya street.

30. O-order na ako. sabi ko sa kanya.

31. Ang karagatan ay malalim at malawak na lugar na puno ng buhay-alon.

32. Lumiwanag ang paligid dahil sa paputok.

33. The height of the basket and the court size varies depending on the age and skill level of the players.

34. Good. Pahinga ka na. Dream of me. aniya.

35. Owning a pet can provide companionship and improve mental health.

36. All is fair in love and war.

37. Ibinigay ko ang lahat ng aking lakas at determinasyon upang makamit ang aking mga layunin.

38. Lumiwanag ang paningin ko sa paliwanag ng guro.

39. In addition to his martial arts skills, Lee was also a talented actor and starred in several films, including The Big Boss, Fists of Fury and Enter the Dragon

40. Nakangiting sagot ni Helena sa binata.

41. En helt kan være enhver, der har en positiv indflydelse på andre mennesker.

42. Napakarami niyang natutunan sa workshop, samakatuwid, handa na siyang gamitin ito sa trabaho.

43.

44. She enjoys taking photographs.

45. Hindi nawawala ang halaga ng panitikan sa pagpapalaganap ng kultura at kaalaman.

46. Iniisip ko ang aking mga pangarap, datapwat alam kong ito ay magiging mahirap abutin.

47. Mayroong konsyerto sa plasa mamayang gabi.

48. Seeking support from friends, family, or a mental health professional can be helpful in managing feelings of frustration.

49. Gayunman, si Cupid ang nabighani sa kagandahan ni Psyche.

50. Viruses are small, infectious agents that can infect cells and cause diseases.

Recent Searches

edsahigh-definitiongiverdefinitivotoymakisuyosaktanitinaobproducereriligtasnakilalamabagalkumapitnabiglacompletamentemensnagpasannaawasunud-sunodanihinasiaticnenaathenamaliitparehasbagalnothingkingdomsalatinracialnasuklamlangkaybisikletananoodlutuinsamesyncvisualthirdviewbehaviorstatinghalosnilulonuposinampaldipangpumatollookedseniorpagkaingnagpakilalacollectionsilogorugaconsistlutolossiguhitniyogeveninglinemalabobinabaanimaginationdeathcryptocurrencyfakeformjunioviewsbubongkarnabalfencingwealthsincepalipat-lipatmagnakawshiftumisiphumahangoskumunotdraft,iba-ibangnamulatkidlatbalitanaglalabaknowledgenagtaposlilipadtraditionalidiomaakinhinakaraniwangtataaswaterpadabogairconsumuotmapahamakbinasamaduraslitodulacontestbeerubonatutoksolidifyyoungnagtanghalianpatakasalamidanjopinakamatapatkakaibangsagotcondomamasyallaamanginordermangkukulamorkidyascurrentperwisyoikawkanayangpiyanooxygennewspapershumahabanapakabutidatamapag-asangbalediktoryanbwahahahahahanagpasalamatnapakalakipansamantalamasayang-masayavirksomheder,direksyonbopolspamamaganapapatungotinatawagmakauuwilumalakinakapagngangalitkumukulonakakapamasyalpaanongculturepag-aapuhapinaabotpaki-drawingnakapaligidnagawangkabundukannagwelgapapanhikproblemanageespadahanangkanaplicacionesbisitabeautymovienakuhanagalitlunesmaulinigannakakaenglobalisasyonpaksahesuseroplanoawitinprutasakoamountnangingitngitsukatkainisdoktormajornanaisinkumirotlaruinnamuhaydispositivotinaynareklamomasaholpinipilittutusinipinauutangbasketbol