Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. It's wise to compare different credit card options before choosing one.

2. Jennifer Aniston gained fame for her role as Rachel Green on the television show "Friends."

3. The policeman directed the flow of traffic during the parade.

4. Nanghihinamad at naghihikab na iniunat ang mahahabang kamay.

5. Nakakapagod pala bumaba ng bundok.

6. Está claro que la evidencia respalda esta afirmación.

7. Saan ba? Wala naman ako allergy eh, palusot ko lang.

8. Kevin Durant is a prolific scorer and has won multiple scoring titles.

9. Namnamin mo ang ganda ng paligid sa takipsilim.

10. Sa kanyang huling araw sa opisina, nag-iwan siya ng liham ng pasasalamat sa kanyang mga kasamahan.

11. Napakabilis ng wifi sa kanilang bahay.

12. Madalas akong magkaroon ng agam-agam sa aking mga desisyon dahil sa aking takot sa pagkakamali.

13. Sa sobrang antok, aksidente kong binagsakan ang laptop ko sa sahig.

14. The most famous professional football league is the English Premier League, followed by other major leagues in Europe and South America.

15. When the blazing sun is gone

16. Ano ang gagamitin mong hiwa ng baka?

17. Emphasis can help clarify and reinforce the meaning of a message.

18. Hindi ko man masabi sa iyo nang harapan, pero crush kita nang sobra-sobra.

19. Ang paggamit ng droga ay hindi lamang masama sa katawan, kundi pati na rin sa isipan.

20. Talaga? Sige nga ipakita mo nga saken.

21. Bagay na bagay kayong dalawa. Paano ba kayo nagkakilala?

22. Ang pagkakaroon ng tamang kaalaman at kakayahan ay makakatulong upang maibsan ang pangamba.

23. Kinakailangan niyang kumilos, umisip ng paraan.

24. The two most common types of coffee beans are Arabica and Robusta.

25. Scientific analysis has revealed that some species are at risk of extinction due to human activity.

26. Tsong, hindi ako bingi, wag kang sumigaw.

27. Kung ako si Maico? Malamang magwawala ako. aniya.

28. Les enseignants peuvent participer à des formations continues pour améliorer leurs compétences pédagogiques.

29. Bis morgen! - See you tomorrow!

30. He used his good credit score as leverage to negotiate a lower interest rate on his mortgage.

31. Kahit ilang beses ko na siyang tawagin, tulala pa rin siya sa kanyang pagmumuni-muni.

32. Ang salarin ay nahuli matapos ang matagal na manhunt ng mga awtoridad.

33. She has been exercising every day for a month.

34. Ang mga kasal ay karaniwang nagaganap sa mga simbahan, katedral, o sa mga magagarang venue.

35. Musk is the CEO of SpaceX, Tesla, Neuralink, and The Boring Company.

36. Magsi-skiing ako sa buwan ng Enero.

37. La realidad es que debemos tomar decisiones difíciles a veces.

38. May pumupunta sa Seasite minu-minuto.

39. El graffiti en la pared está llamando la atención de la policía.

40. "Tuloy po kayo," ani ng matanda sa bisita niyang dumating.

41. Ito na ang kauna-unahang saging.

42. Sa isang malakas na bagyo, hindi ko na nakita ang aking mga kasama dahil sa sobrang pagdidilim ng paningin ko.

43. Binigyan niya ng kendi ang bata.

44. You need to pull yourself together and face the reality of the situation.

45. Ang sugal ay isang pampalipas-oras na aktibidad na may kaakibat na panganib ng pagkakabigong pinansyal.

46. Nakatira si Nerissa sa Long Island.

47. Hihiramin ko sana ang iyong kopya ng libro para sa aking assignment.

48. He has fixed the computer.

49. Paglingon ko, nakita kong papalapit sakin si Lory.

50.

Recent Searches

utilizareducationhigh-definitionipapahinganotebookdarkmulighedmesangdinalawhydelprimerkerbsamfund1980centeripinadalawaylordhidingaddingprogramminguloexistwhiledifferentpublishedaffectactivitycharitableinfluencegotcosechar,nerissacomputereparangsilbingpagbabayadwouldpagkainisnagtatakboforskelsumisidtabaguropagraranasroofstockmatagumpaylipadhinognahihiloyelonakikilalangdingdingscientistbagamanaglutoinomtawanantalagaumokayibabawwakasvalleynangyarinakakapamasyaladvancednamemadalingtabasinaapiinstitucioneskailanmanpadaboglaki-lakipantalongnagpabotsalapalamutiumagawmalasutlakaarawansumasayawmalezapinapatapossinagotumilingkahoydiseasesnangingisaynaguguluhannakikini-kinitasakalinghumihinginakaliliyongkalongpagkahapobyggetramdamilocossupportpagmasdanscottishfreelancernuhnagtataasmaligayamedyomusicianbangladeshjoselumuwasbinilingfurgulangtrackpalapitmarketingnagbanggaansumabogpumikitnakapagproposectricaspaglisanipapainitiyonagwadornanlilimahidaalisnogensindelifegabrielnapasigawmatapangtiyakcirclekahirapanburgerfrescopooknaiilagansalaminpanghihiyangtransmitsguitarranapadaanoperategenekatolisismoumiinomnakakitahitsurapinalutopangangatawanbestidapagbigyanmadalaskalalarokabiyaknagpakitamurang-muraseguridadnananalopagsumamodinanasnagbantayliv,makatarungangnaguguluhangmauupoflyvemaskinermagbantaybumabahaalayiyonagpalalimroselleganapintumahimikpagkapasokmalakasnandiyannilolokomabangonagtrabahopagngitimanuksopakibigaymag-anakfonosniyonagdalaestablishnabuhaysaidtwinkledrenadocryptocurrencypumasokmagpuntamest