Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Keluarga sering kali memberikan hadiah atau uang sebagai bentuk ucapan selamat kepada ibu dan bayi yang baru lahir.

2. Batang-bata ako nalalaman ko 'to.

3. Ang mga dahon ng bayabas ay nagagamit din sa medisina.

4. She has been exercising every day for a month.

5. He blew out the candles on his birthday cake and made a wish.

6. Iiwan lang kita pag sinabi mong iwanan na kita..

7. Nagmumukha siyang Intsik-beho kapag suot iyon ngunit wala naman siyang maraming kamisetang maisusuot.

8. Ibinigay ng titser ang libro sa estudyante.

9. Tahimik ang kanilang nayon.

10. Marami ang dumarayo hindi lamang para bumili ng mga disenyo kundi upang makita rin ang paggawa ng bata.

11. Uuwi na ako, bulong niya sa sarili.

12. Sa dapit-hapon, masarap magpakalma sa gitna ng kagandahan ng kalikasan.

13. Pakibigay sa tindera ang tamang bayad para hindi siya malugi.

14. Tomar decisiones que están en línea con nuestra conciencia puede ayudarnos a construir una vida significativa y satisfactoria.

15. The team has had several legendary coaches, including Phil Jackson, who led the Lakers to multiple championships during the 2000s.

16. Hindi pa namin napapag-usapan eh. sagot niya.

17. Grover Cleveland, the twenty-second and twenty-fourth president of the United States, served from 1885 to 1889 and from 1893 to 1897, and was known for his economic policies and opposition to corruption.

18. Controla las plagas y enfermedades

19. It's important to maintain a good credit score for future financial opportunities.

20. Mayroon ba kayong reaksiyon, Senador Ferrer?

21. Bago magsimula ang kasal, nagdaos sila ng tradisyunal na ritwal upang basbasan ang mag-asawa.

22. Pull yourself together and stop making excuses for your behavior.

23. Nahanap niya ang nawawalang susi sa ilalim ng tarangkahan ng kotse.

24. Mga mangga ang binibili ni Juan.

25. Naglinis kami ng bahay noong Linggo.

26. Los héroes inspiran a otros a levantarse y luchar por lo que es correcto.

27. Los héroes son capaces de cambiar el curso de la historia con sus acciones valientes.

28. Biglang nagtinginan sila kay Kenji.

29. Dumating siya sa tindahan ng mga tuyong paninda at bumili ng isang kartong mantika.

30. That article might not be completely accurate, so take it with a grain of salt.

31. Marahil anila ay ito si Ranay.

32. Hendes skønhed er betagende. (Her beauty is mesmerizing.)

33. Det er vigtigt at huske, at helte også er mennesker med fejl og mangler.

34. Ang talambuhay ni Andres Bonifacio ay nagpapakita ng kanyang matatag na pagtitiis sa gitna ng mga pagsubok.

35. Bagaimana pendapatmu tentang film yang baru saja tayang? (What is your opinion on the latest movie?)

36. Sa dakong huli ko lang narealize na mali ang ginawa ko.

37. I know you're going through a tough time, but just hang in there - you're not alone.

38. Pakibigay na lang ang mensahe ko kay Miguel kung hindi ko siya maabutan.

39. Nasi goreng adalah salah satu hidangan nasional Indonesia yang terkenal di seluruh dunia.

40. Women have faced discrimination and barriers in many areas of life, including education and employment.

41. Mahigit sa walong oras siyang nagtatrabaho araw-araw upang matustusan ang kanyang mga pangangailangan.

42. Electric cars can support renewable energy sources such as solar and wind power by using electricity from these sources to charge the vehicle.

43. The Petra archaeological site in Jordan is an extraordinary wonder carved into rock.

44. She has been cooking dinner for two hours.

45. Nakita kita sa isang magasin.

46. Iginitgit din niya ang sa kanya, bahagya nga lamang at takot na paggitgit.

47. Nakuha niya ang mataas na grado sa pagsusulit, bagkus hindi siya gaanong nag-aaral ng mabuti.

48. Nationalism can be both inclusive and exclusive, depending on the particular vision of the nation.

49. All these years, I have been chasing my passions and following my heart.

50. Pagkatapos ng ulan, naging maaliwalas ang kapaligiran.

Recent Searches

high-definitionnoonpangalanambagsagapcompositoresnag-poutdirectasinunud-ssunodscottishtseskypelandomansanaspatitresadopteddinanasmartesisinampaynahigaomkring11pmguhitbilugangbegansigejoepalapitwariwalagamitinkawili-wilinakanganganggawainghangaringindividualcivilizationallowingexcusebangpanaymarioespigaslamanmaka-yoikinuwentohanbumugaoutpostbabaepinakamalapitnagreplychoice10thvideodalawitimsinipangkaawa-awangnaroonlockdownfeelingipinagbilingfloorfaultdelejamespalaginginamintaga-suportanakapagusapmultonutsdingdingbringingmainstreamlibageasyviewsobstaclesdollarfataladdingincludeprocesscertainpamumuhaybetweencontrolaeitherryaninterviewingritwalkasiyahangdonipagmalaakipag-asanapakahusaynag-away-awaynag-iimbitagiftipaghandamahinabecomesmaalalanumberlosmamahalindreamseksamenkaloobanmagpapalitkapasyahannamasyallagnatworkingbilangguanliketoycombatirlas,friendnagmasid-masidmatamisexpensesdagat-dagatanidolalas-dosengumititandanglandslideomfattendematitigasyumanigmagtrabahohumanapinspirationdejapumuslitnasusunogbopolsumimikpinagwikaandemkeepingkapainpicturegovernmentnapakalakasnogensindepakelameroapoynapabayaanblazinggalawmagbagong-anyotilltagagumalingpaghuhugasnapakaselosokagandahankoryenteso-calledkaparehaandamingpagbisitanaalaalapartyrolltonightbungahawakanshowprovebinigyanforcesmulitingingsystems-diesel-runmbalosourcespromotingpunung-punobonifacionagtalagaagwadoralespagkakapagsalitamag-alalamaximizingnag-aasikasokagubatansasagutinnariningnagpepekebumisitanakasahodpinabayaannapakaalat