Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Padalas nang padalas ang mga nawawala kaya't lumapit ang taong bayan sa kanilang makisig na hari upang humingi ng tulong.

2. Sopas ang ipinabalik ko sa waiter.

3. Es difícil saber lo que pasará, así que simplemente digo "que sera, sera."

4. Marahil ay nai-stress ka dahil sa mga kailangang tapusin sa trabaho.

5. Ang presyo ng gulay sa palengke ay mababa ngayong linggo.

6.

7. Bumagsak ang nawalan ng panimbang na si Ogor.

8. Negative self-talk and self-blame can make feelings of frustration worse.

9. Tila siya ang paboritong estudyante ng guro.

10. Ang pagguhit ay isang mahusay na paraan upang ipakita ang iyong kreatibidad.

11. Sa pagkawala ng kanilang tahanan, naghihinagpis ang mga pamilyang apektado ng sunog.

12. The bridge was closed, and therefore we had to take a detour.

13. Iron Man wears a suit of armor equipped with advanced technology and weaponry.

14. We sang "happy birthday" to my nephew over video chat.

15. Bumuga na lang ng hangin si Maico saka tumingin kay Mica.

16. En tung samvittighed kan være en kilde til stor stress og angst.

17. Saan na po kayo nagtatrabaho ngayon?

18. Gumamit ang albularyo ng dahon ng bayabas upang linisin ang sugat ni Pedro.

19. Bago pa man maghatinggabi ay dumating nga ang prinsipe at lubos na nalugod ang nag-aalalang prinsesa.

20. But there is a real fear that the world’s reserves for energy sources of petroleum, coal, and hydel power are gradually being exhausted

21. Makalipas ang siyam na buwan, isinilang ang isang napakalusog na batang babae.

22. Isasama ko ang aking mga kapatid sa pamanhikan.

23. Einstein was offered the presidency of Israel in 1952, but declined the offer.

24. Nangahas siyang sumagot sa guro nang hindi nag-iisip, kaya siya napagalitan.

25. The city's vibrant nightlife offers a variety of entertainment options, including nightclubs, bars, and live music venues.

26. Sa kanyang paglalakad, napadungaw siya sa isang tindahan ng kakanin at napabili ng puto.

27. Tumango siya tapos dumiretso na sa kwarto niya.

28. Mathematics provides a systematic and logical approach to problem-solving.

29. Emphasis can also be used to create a sense of urgency or importance.

30. Dalawa ang pambura sa silid-aralan.

31. The rise of social media has further expanded the reach of the internet, allowing people to connect with friends and family, as well as share their thoughts and experiences with a global audience

32. The store offers a variety of products to suit different needs and preferences.

33. Lazada has a strong focus on customer service and has won awards for its efforts.

34. Effective communication and teamwork are important for a successful and productive work environment.

35. Makabalik na nga sa klase! inis na sabi ko.

36. I took the day off from work to relax on my birthday.

37. I complimented the pretty lady on her dress and she smiled at me.

38. Sa mga tabing-dagat, naglipana ang mga maliliit na kabahayan.

39. May konsiyerto ang paaralan at ang mga guro ang magiging bida.

40. Ang mga kabataan ay naglalaro ng computer games hanggang sa hatinggabi.

41. La perspectiva es una técnica importante para crear la ilusión de profundidad en la pintura.

42. Marahil ay kailangan mong magdagdag ng oras sa pag-eensayo upang makamit ang iyong layunin.

43. Kelahiran bayi adalah momen yang sangat penting dan dianggap sebagai anugerah dari Tuhan di Indonesia.

44. Pinagalitan niya ang matanda at tinulak-tulak ito.

45. "Ang hindi lumingon sa pinanggalingan, hindi makakarating sa paroroonan" ay isang bukambibig na nagpapahiwatig ng kahalagahan ng pag-alala at pagpahalaga sa mga pinagmulan.

46. Aalis na ko mamaya papuntang korea.

47. Halos magkasing-edad sila ni Bereti kaya madaling nagkalapit ang mga loob.

48. We were planning on going to the park, but it's raining cats and dogs, so we'll have to stay indoors.

49. Maganda ang website na ginawa ni Michael.

50. Pagkagising ni Leah ay agad na itong naghilamos ng kanyang mukha.

Recent Searches

sitawnogensindehigh-definitionhatepacecablecreatingviewgraduallybabeprotestapointestablishedipatuloyimpactednitongabichavitspeechesweddingserioussinapakgrewseepartybataylingidmahahabamalayainisballprivateyoungmarsobirouriumiilingheycadenaroboticmarchtaga-nayoncigarettebeingareadancenasundocrosscleandebatesofferhardsurgerypromoting4thlcdaboequipopahahanappinunitnapalitangpakibigyankapatidawitanprotegidoanubayannahulaanamendmentsrailwaysownwalisgameeksenanagkakasyatilayonbadingtiyaknagsagawamedicinekagipitantagaytaynapapahintowatawatnakakainkaalamannananalongnapakalusogmagpalagomahinogibinilinagtakadistansyagratificante,makapaibabawmasayang-masayangpunong-kahoymakalaglag-pantymakipag-barkadanagpabayadnakatiranakaririmarimnangampanyamagkakagustomagkaibigannagpapakainmalezapinabayaannag-aalangannanlilimahidnapagtantonaiilaganmedisinanapipilitanbayawaknagtalagasasamahanpagmamanehodiscipliner,pagkatakotpagsisisinagdiretsoinaabutanpaninigasnakatuonnakapagproposetaxinagbentamahuhulikontinentengmiyerkulesmarketing:naiilangdispositivoinagawpakikipaglabansakupinlumipadpinabulaansakalingnasunogsurveyspalantandaanxviihonestomilyongtig-bebeintepapuntangjosietutusinpalamutimatataglandasmetodisktirangpromiseaayusintelephonebahagyanghawlapinaulananmatutongkumantaestadoskauntipabilianghelnatitirakinalimutanhabitangkoptangansakimngisisementopokernilayuanalleeleksyonarabiamay-ariubonahihilokabuhayan1950sgagtalentilawbumototarcilainalagaanhikingpalakasinelimitedninamusicalisaacrosasilbing