Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Nag-asaran, naglokohan at nagtawanan sila.

2. Siniyasat ni Sangkalan at ng mga tao ang puno.

3. Samantala sa trabaho, patuloy siyang nagpapakasipag at nagsusumikap para sa kanyang pamilya.

4. Las hierbas de provenza son una mezcla de distintas hierbas secas, ideales para condimentar platos.

5. Nagsmile si Athena tapos nag bow sa kanila.

6. Membuka tabir untuk umum.

7. Nakatanggap ako ng email sa dakong huli ng gabi mula sa aking boss.

8. Ang daming limatik sa bundok na kanilang inakyat.

9. I know I'm late, but better late than never, right?

10. Araw araw niyang dinadasal ito.

11. Ang mailap na pangarap ay kailangan paglaanan ng pagsisikap upang magkatotoo.

12. may butil na rin ng pawis sa kanyang ilong.

13. Itim ang gusto niyang kulay.

14. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

15. Amning er en vigtig del af den tidlige babypleje.

16. Higupin mo muna ang sabaw bago kainin ang noodles.

17. Isang araw, tinikman ni Datu Duri ang isang hinog na bunga.

18. Napaluha si Aling Pising nang makita niya ang bunga nito.

19. Buti naman. Ayoko mahawaan ng kuto eh.

20. Masarap magluto ng midnight snack sa hatinggabi kapag nagugutom ka.

21. I usually stick to a healthy diet, but once in a blue moon, I'll indulge in some ice cream or chocolate.

22. Ang editor ay nagsusulat ng mga komento at mga pagsusuri sa mga akda ng mga manunulat.

23. La science des matériaux permet de développer de nouveaux matériaux pour de multiples applications.

24. Ina, huwag mo po kaming iwan! ang iyak ni Maria.

25. Les maladies cardiaques, le cancer et le diabète sont des problèmes de santé courants dans de nombreux pays.

26. En casa de herrero, cuchillo de palo.

27. Nalaman ito ni Venus at binigyan ng pagsubok sina Psyche at Cupid na nalagpasan naman nila at nagsama sila nang matiwasay.

28. Les enseignants peuvent adapter leur enseignement en fonction des besoins et des niveaux de compréhension des élèves.

29. Bumili kami ng isang mapa ng kalakhang Maynila para mas magaan ang pag-navigate sa lungsod.

30. Puwede ba bumili ng tiket dito?

31. Internal Audit po. simpleng sagot ko.

32. Nationalism is a political ideology that emphasizes the importance of the nation-state.

33. "Every dog has its day."

34. Drømme kan være en kilde til trøst og håb i svære tider.

35. Les enseignants peuvent être amenés à enseigner dans des écoles différentes en fonction de leurs besoins professionnels.

36. Hindi dapat asahan na madaling makakuha ng tagumpay kung mailap ang pag-asa.

37. Pagkaraan ng ilang araw ay magaling-galing na si Aling Rosa.

38. Saan nakatira si Ginoong Oue?

39. Hindi magandang magpakita ng pagmamalabis sa pagkakain sa mga simpleng pagtitipon.

40. Limitations are a part of life, and how one approaches and overcomes them can shape their character and experiences.

41. Nakapagtataka na may ilang tao na hindi pa nakatikim ng pulotgata.

42. Sino ang mga pumunta sa party mo?

43. Maramot siya sa pagkain kaya hindi niya binibigyan ang kanyang mga kapatid.

44. Ang albularyo ay gumamit ng langis at kandila upang tukuyin kung may masamang espiritu sa bahay.

45. Masasabi ko na ang mga kanta ng Bukas Palad ay nagbibigay sa akin ng kapayapaan at kapanatagan.

46. Deep learning is a type of machine learning that uses neural networks with multiple layers to improve accuracy and efficiency.

47. No dejes para mañana lo que puedas hacer hoy.

48. En helt kan være enhver, der har en positiv indflydelse på andre mennesker.

49. Setiap agama memiliki tempat ibadahnya sendiri di Indonesia, seperti masjid, gereja, kuil, dan pura.

50. Hindi lang nila naririnig kundi nakikita pa ang katuwaan ng lahat.

Recent Searches

high-definitionrimaspinagtagpodiyaryopinigilanipinatawagumiimikvidtstraktnasiyahantravelna-fundnangangaralnalalamanmagkaparehopagtataposlutotatawagmakakawawanaibibigaypagtatanongmagpaliwanagnagkakasyaseenagdarasalsumakitsubject,sarisaringliligawanmatumalnabiawangdesign,toypilitpatientpakaininkinalimutannakakunot-noongtusindvispangkaraniwangkapenakasuotsinampalbingidangerousanitodakilanglimosfakebinibinihangaringmenosbusiness,soonpropensocompostelabitiwan1787connectingbroughtabonodemocraticpayadverselywidespreadpagejanesumugodsumindilatestwordsipagamotmayitimhinagisaddictiontataasemailinisipinabalikkitangmuchasplayedfacebookgodwatchcoinbasemillionsellaspaghettideneveninggamemeandaangtvsprivatetsaacountriescommunicationsgraduallyeveryaddressviewsvasquescouldclientesmulti-billionipipilitsulinganpartfarvisualguidebituincharitablealignsknowgenerabaamountenterappdraft,remembertabacoincidenceinastanamangkundikuboanubayanbeforekelanthoughtsnamumulaklaknakapangasawadescargarrevolucionadobarung-baronggratificante,sikipmadalingplasakaybiliscashbarangaymakahihigitgjortexperts,kabarkadadalirieksperimenteringhojaswhilelibagcontinuednotebookgotamericacurrentreaditemssakimmalapitannenapinisilsmiledrawingnakabanggaumiibignakabibingingcultivationpakikipaglabanlalabasproudopomarmaingiconicdaladalanaiinitanipagtimplakawili-wilinagmamaktolnanlilimahidpagkamanghainaaminpagkalitogulatsasagutinnaiilaganmaynilanakapagproposebusiness:isasamaunangusapaskoyepencompasseslayasganting