Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Cada vez que cosechamos las frutas del jardín, hacemos una deliciosa mermelada.

2. Las escuelas ofrecen actividades extracurriculares, como deportes y clubes estudiantiles.

3. Ano ang ininom nila ng asawa niya?

4. Kapareha naman ni Kangkong ang Sitaw, ni Mangga ang Dalanghita, ni Saging ang Papaya.

5. Hindi siya maramot sa pagbibigay ng kanyang mga lumang damit sa mga nangangailangan.

6. Waring malungkot siya ngayon, ngunit hindi niya sinasabi kung bakit.

7. He has been named NBA Finals MVP four times and has won four regular-season MVP awards.

8. Ang pagtulog ng tamang posisyon ay maaaring makatulong sa pag-iwas sa mga sakit sa likod at leeg.

9. Nagka-bungang-araw si Baby dahil sa sobrang init.

10. Matapos ang isang matinding pagsubok, hindi maiwasan ang paglabas ng malalim na himutok.

11. Up above the world so high

12. Les travailleurs peuvent changer de carrière à tout moment de leur vie.

13. Think about what message you want to convey, who your target audience is, and what makes your book unique

14. Ang department of education ay nabigyan ng malaking pondo ngayong taon.

15. Oh, Attorney! Kamusta po? magalang na tanong ko.

16. L'intelligence artificielle peut être utilisée pour détecter et prévenir les activités criminelles.

17. Tantangan hidup dapat muncul dalam berbagai bentuk, baik dalam bidang pribadi, profesional, atau emosional.

18. Pasensiya na kayo, Ale, sabi ng bata.

19. Some ailments are preventable through vaccinations, such as measles or polio.

20. The telephone quickly caught on, and by 1878, Bell's company, the Bell Telephone Company, had more than 50,000 subscribers

21. Ilan ang computer sa bahay mo?

22. Nakatayo ang lalaking nakapayong.

23. Tinangka niya itong pigilan ngunit huli na ng naabutan niya ang matanda.

24. Oscilloscopes display voltage as a function of time on a graphical screen.

25. Dumating ang mga kamag-anak ni Fe.

26. Les astronomes étudient les étoiles et les galaxies.

27. Orang Indonesia memiliki beragam tradisi dan budaya dalam melakukan doa.

28. Nakaupo ako nang matagal sa sinehan.

29. Kinakailangan niyang kumilos, umisip ng paraan.

30. Mahirap ang walang hanapbuhay.

31. "A dog wags its tail with its heart."

32. Ang droga ay hindi nagbibigay ng solusyon, kundi dagdag na problema pa.

33. Nag-ugat sa puso ni Durian na mahalin ang sakop ng kanyang ama.

34. May I know your name so I can properly address you?

35. Børns leg og kreativitet er en vigtig del af deres udvikling.

36. Emphasis can be used to create rhythm and cadence in language.

37. Sweetness is a sensation associated with the taste of sugar and other natural and artificial sweeteners.

38. Para relajarme, suelo hacer yoga o meditación como pasatiempo.

39. Det er vigtigt at have gode handelsrelationer med andre lande, hvis man ønsker at eksportere succesfuldt.

40. Lahat ng magagaling na maghahabi ay napakahanga sa kakayanan ni Amba.

41. Que tengas un buen viaje

42. Hindi naman halatang type mo yan noh?

43. Dapat supilin ng pamahalaan ang mga kriminal na nagpapahirap sa mga inosenteng mamamayan.

44. Nakalimutan kong magdala ng lapis sa silid-aralan kaya nagpahiram ako sa aking kaibigan.

45. Nanalo siya ng isang milyong dolyar sa lotto.

46. How I wonder what you are.

47. Ang pagtambay sa ilalim ng puno ay nagdudulot ng maginhawang lilim mula sa init ng tanghali.

48. Ang pangamba ay maaaring maging dahilan ng hindi pagpunta sa mga lugar na hindi pamilyar sa atin.

49. Tumingin siya sa akin, waring may nais siyang ipahiwatig.

50. Tradisyon na nang mga Pilipino ang pagsisimbang gabi.

Recent Searches

riyanbecamehigh-definitionprofessionalcadenawatchdamitintroducesaringnathanformasresearchideastherapywordsdulaunderholderarmedmonetizingendbaldelikelyhowevernaroondidingaddresspanguloconcernsmatangumpayellaeksempeldeletingamerikawonderkinakailangannamangfridayniligawankomedorhanapbuhaynakunoongyeppatakboitinaasdalawangmaskarabiniliconsiderpampagandakabilangrelolasingerokalakinginatmicatugongalaanjosesinapakmahahabanagsisilbipookgeologi,juliuskinainnyanmahinanageespadahanpodcasts,lackdahilmagsasalitaalaybihiravocalpapagalitanelectionssumabogkulunganmathcommunicatedifferentcleanbiropagpasokkanilahayaangsinaliksiklandlinetumatawagnahintakutannasiyahanmindpinagkaloobanmatutulogspeechbungangvedasthmakaraokeflamencopanunuksobowlenergynapasubsobtahananngumingisitinutopnalalaglagmoviessabihingunangnakasalubongguitarratinaynalakianimmagawangpistapambatangtangeksmanatilikutsilyoairplanesligaligpaghahabimaulinigansakimmagkasamakarapatangkamiasengkantadangnaiilangsistemasnapatulalaprimerospagbabayadasignaturapagsagotganangkubyertosmasayang-masayangnagdadasalikinakagalitkalalakihannakakitapagkalungkotdyanoffentliglightspitakaadaptabilitydaigdig4thbelievedbatihulingandyfacultymagkahawakreservationechavekaguluhanpagsubokwariayawmonsignorcarspakanta-kantangnakakarinigmaaaringnakatuwaangnagulatnananaginiptravelpagtutolleksiyonnag-poutpamilihanmasayahinnakikiahampaslupacorporationyouthinakalapilipinasmalulungkotnalamanincluirtotoongmedicalpalagingtinakasanpabulongcualquieriiwasannanangismagsisimulanatabunan