Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. H-hindi na sabi eh! inis na sabi nya.

2. Sang-ayon ako sa panukalang ito dahil makakatulong ito sa mga nangangailangan.

3. Minsan ay isang diwata ang nagpanggap na isang babaeng madungis.

4. If you're trying to convince me that he's a bad person, you're barking up the wrong tree.

5. El arte puede ser interpretado de diferentes maneras por diferentes personas.

6. Ako ay nag-aalala para sa aking pamilya, datapwat wala akong magagawa para sa kanila ngayon.

7. Bigla niyang naalala si Helena, napatigil siya sa kanyang pag-iyak at napangiti na lang ang binata.

8. Maaliwalas ang simoy ng hangin sa probinsya.

9. He does not break traffic rules.

10. This house is for sale.

11. Ang buhawi ay maaaring magdulot ng malawakang pinsala sa mga ari-arian, gusali, at mga taniman.

12. Isinaboy niya ang tubig na nasa harap.

13. Habang nglalaba si Aling Rosa at iba pang may-bahay ay masayang nalalaro at naliligo ang mga bata.

14. Maganda ang mga alaala ko dito sa Pilipinas.

15. Translation: I cannot change the past, I can only accept it with "what will be, will be."

16. If you did not twinkle so.

17. Forgiveness is not always easy, and it may require seeking support from trusted friends, family, or even professional counselors.

18. Sweet foods are often associated with desserts, such as cakes and pastries.

19. Hindi mo alam ang sagot sa tanong? Kung gayon, dapat kang mag-aral pa.

20. Beinte pesos ang isang kilo ng saging.

21. Tumayo na sya, Ok! I'll be going now, see you tomorrow!

22. Las escuelas tienen un impacto significativo en el desarrollo de los estudiantes y su futuro éxito en la vida.

23. Football referees are responsible for enforcing the rules of the game and ensuring player safety.

24. Maskiner er også en vigtig del af teknologi

25. May sapot pa ng gagamba sa kanilang kisame.

26. Når man bliver kvinde, åbner der sig mange nye muligheder og udfordringer.

27. Sa ilalim ng lumang kahoy, natagpuan namin ang malamig na lilim na nagbibigay ng kapahingahan sa aming paglalakbay.

28. Pagkain ko katapat ng pera mo.

29. Kumusta ang nilagang baka mo?

30. Sayang, aku sedang sibuk sekarang. (Darling, I'm busy right now.)

31. Einstein was a vocal critic of Nazi Germany and fled to the United States in 1933.

32. Kucing adalah salah satu hewan peliharaan yang populer di Indonesia.

33. Nang magretiro siya sa trabaho, nag-iwan siya ng magandang reputasyon bilang isang tapat at mahusay na empleyado.

34. Crush kita alam mo ba?

35. Pumasok ako sa klase kaninang umaga.

36. Halos hindi niya narinig ang halingling ni Ogor.

37. La labradora de mi cuñado es muy ágil y puede saltar obstáculos muy altos.

38. Ako ay nanatili sa iyong pagkatao subalit nagpadala ka mga pagsubok.

39. Traffic laws are designed to ensure the safety of drivers, passengers, and pedestrians.

40. Galit ng galit ang ama ni Bereti nang may nakapagsabi na namumulot at kumakain ng tirang pagkain ang anak.

41. Nagsusulat ako ng liham upang ipahayag ang aking pasasalamat.

42. Don't be fooled by the marketing gimmick, there's no such thing as a free lunch.

43. Mayroon pa ho sana akong gustong itanong.

44. Cars, airplanes, and trains have made it possible for people to travel great distances in a relatively short amount of time

45. Hindi niya iningatan ang kanyang cellphone, samakatuwid, nasira ito agad.

46. El maíz necesita sol y un suelo rico en nutrientes

47. Dahil ang alam lang ay kumain, hindi alam ni Ranay kung paano ma-buhay na siya ang kikilos at magta-trabaho.

48. Hindi ko sinasang-ayunan ang kanilang ideya kaya ako ay tumututol.

49. Analog oscilloscopes use cathode ray tubes (CRTs) to display waveforms.

50. Sa pagguhit, mahalaga ang pagpili ng tamang kasangkapan tulad ng lapis, papel, at krayola.

Recent Searches

high-definitionpuwedepssskaugnayanaffiliateiconssigloumalishikingbulakdefinitivomedicinetumaggapguidancesinipangpinatidselllegendstendertapat1787ahitmatuklapmadurascassandraasoutilizabilaopancitlintaechavesabikasuutanpasswordmagalingklasrummatalingiddaancoaching:selasteveprovidepagtataposnatingalatherapyroseklimaprocesolatestmoodipagbilinuonmisusedwalisatentoano-anoginugunitamurangnagwagitseminerviebritishsubalitomgsupilinpookareapapuntapaslitnamekapangyarihansaginglayout,roleexpertgracefuncionestandapaamapakaliyearsmulicoinbasemanghulipag-iyakdeclarelibaggottiyamaputieverybathalaspeechpinilingschoolaidresponsibledaratingtipidpersonsideajangabi-gabinaghihinagpisnagsmilestrategiesangkanisinuotmaaariyatanangangaralpalengkenewspaperssourceusingprogramsshiftandroidcuandoitemsrequiredulolutuinelecttechnologyincreasecomunicarsenamungasapotsambitbinatilyoipanghampasyanmagbabagsik1970souekargangcrazymagkakailapanindanggodnatutulogpagdukwangmustnagdaraanpaiddinnamanparticipatingisulatmaghaponalituntuninmasteropportunitypauwilaruinforskel,lumagopagpasensyahanleadersgainfilipinanglalabaanotherkakayananamingpaki-drawingbecamekapagituturoaniapoynagdaramdampromotelalabashverbutterflykinatatalungkuanggoalngayonebidensyavideosinuulamsulyapsapagkattuluyancarskinasisindakanbumababagutomsusunodnasiyahanpinakamahabalabankasingipinunattendedmarahasmakapiling