Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Tantangan hidup dapat menguji kemampuan dan ketangguhan seseorang, membantu kita mengenal diri sendiri dengan lebih baik.

2. Elon Musk is a billionaire entrepreneur and business magnate.

3. Las redes sociales pueden ser adictivas y consumir mucho tiempo.

4. She wakes up early every morning to exercise because she believes the early bird gets the worm.

5. Sa mga nakalipas na taon, yumabong ang mga organisasyon na tumutulong sa mga nangangailangan.

6. Matagal ko nang pinapaliwanag sa kanila ang mga dahilan kung bakit ako tumututol sa kanilang plano.

7. Det har også ændret måden, vi producerer ting og øget vores evne til at fremstille emner i større mængder og med højere præcision

8. Tinangka umano ng pulis na kausapin ang mga nagpoprotesta bago sila buwagin.

9. Maliit lang ang kusina ni Lola Oliva.

10. Napuyat ako kakapanood ng netflix.

11. Ultimately, a wife is a partner and equal in a marital relationship, contributing to the success and happiness of both spouses.

12. They have donated to charity.

13. Many people turn to God for guidance, comfort, and solace during difficult times in their lives.

14. Hindi dapat maapektuhan ng kababawan ng mga tao ang ating mga desisyon sa buhay.

15. Las hojas de palma se usan a menudo para hacer sombreros y cestas.

16. Has he finished his homework?

17. Pumunta daw po kayo sa guidance office sabi ng aking teacher.

18. Aling telebisyon ang nasa kusina?

19. She has made a lot of progress.

20. Las hierbas frescas añaden un toque de color y sabor a las ensaladas.

21. Las rosas rojas son un regalo clásico para el Día de los Enamorados.

22. Siembra las semillas en un lugar protegido durante los primeros días, ya que el maíz es sensible al frío

23. Te agradezco por estar siempre ahí para mí.

24. Ang pag-asa ay nagbibigay ng kahulugan sa buhay ng mga tao sa pamamagitan ng kanilang mga pangarap at mga layunin.

25. Hindi tayo sigurado/nakatitiyak.

26. He has been practicing yoga for years.

27. Jeg kan godt lide at skynde mig om morgenen, så jeg har mere tid til at slappe af senere på dagen. (I like to hurry in the morning, so I have more time to relax later in the day.)

28. Huminga ka ng malalim at tayo'y lalarga na.

29. Una mala conciencia puede llevarnos a tomar malas decisiones.

30. Before television, most advertising was done through print media, such as newspapers and magazines

31. Akma siyang tatayo upang humingi ng tulong ng bigla siyang nalugmok sa kanyang kinauupuan.

32. Ang edukasyon lamang ang maipapamana ko sayo.

33. Napakabagal ng proseso ng pagbabayad ng buwis, animoy lakad pagong.

34. Hendes livsstil er så fascinerende, at jeg ønsker at lære mere om hende. (Her lifestyle is so fascinating that I want to learn more about her.)

35. Inflation kann durch eine Zunahme der Geldmenge verursacht werden.

36. Namilipit ito sa sakit.

37. Bale, Wednesday to Friday ako dun.

38. Oy saan ka pupunta?! Bayad ka na!

39. Es freut mich, Sie kennenzulernen. - Nice to meet you.

40. Ang aking kabiyak ay ang aking kaligayahan at kabuuang kaganapan sa aking buhay.

41. Ano bang sakit niya? Inuulcer pa rin ba siya?

42. Sang-ayon ako na kailangan nating magkaroon ng sapat na pondo para sa pagpapaunlad ng ating mga komunidad.

43. Ang aming angkan ay nagpapahalaga sa pagiging matapat sa mga relasyon.

44. This has led to a rise in remote work and a shift towards a more flexible, digital economy

45. May bumisita umano sa bahay nila kagabi ngunit hindi nila nakita kung sino.

46. Las escuelas también ofrecen programas de educación para adultos.

47. The Watts Towers, a collection of unique and intricate sculptures, are a testament to the city's artistic expression.

48. Hindi ko maintindihan kung bakit kailangan ko pang magtiis sa ganitong sitwasyon.

49. Ayaw mo ba akong kasabay? maya-maya eh tanong ni Anthony.

50. Kuwartong pandalawahan, hindi ho ba?

Recent Searches

high-definitiondietpeterpshbitawanisaactipidaidlabing-siyamprimernababalotmagpaliwanagsipabehaviorulingwifileftrebolusyonprocesskumukulorestgenerabauugod-ugoddifferentlumamanggeneratedartificialnaiinggittipmakingmakikikainandroidoverviewsutillumayonagkakatipun-tiponmanamis-namisrawamendmentsinteracthoweverhulingcomputere,guidanceadaipinaalamnagdiretsopracticesgitanasstructureexplainlaganapgitaranapapikitlumibotmethodsadditionbituinnagdabogtilbitbitlindoltrabahosaudiopisinapresleymatagalkaibaahitremotemaasahantelephonewellyunmalayasarilikabuhayanparusasumunoddumikittahananbibigyanngunitnotebookusurerobinilipresenceditouuwisiglapadaboghigantenagtatakasilid-aralanhukaymaglalabing-animasamatustusanmaramiequipochessnauliniganincludecentergrupolumitawnanaywalisraymondexpressionsestánilayuanmapagodwatawatisinalaysaymatakawnanahimikrestawansinalansankaagawmagta-trabahoasignaturaconclusiongayaginagawasiniyasatnaminextremistnagtinginanfilmshetpunung-kahoypagtingintawabakakayanakabibingingkumampitamasuchhulihanpangambabumababamapahamakfestivalesetomatalinotutubuiniwansapagkatkabosesmaestratumatakbonahuhumalingotrasnalalarodahilanmightnag-umpisaabangkaawaytinapaymalakasmainitnapapalibutannag-aarallinggonginantaypagpapasakitkahongbentangumakyatdurisasakyansigningspinatutunayanlungkutpinggankatotohanansellmalaki-lakihila-agawanfacebookipapainittsuperdiseaserecentlygutomtinanggapnakakalayoanisigafloorcruzginoonaglaonlumiwagnagitlaganitomalusog