Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Napahinto kami sa pag lalakad nung nakatapat na namin sila.

2. Las serpientes son reptiles que se caracterizan por su cuerpo largo y sin extremidades.

3. Nanatili siya sa pagkakatayo nang ilang saglit, wari'y tinakasan ng lakas, nag-iisip ng mga nakaraang pangyayari.

4. Sa gitna ng parke, nahanap namin ang lilim ng malalaking puno na perpekto para sa aming piknik.

5. Sa bawat Chinese New Year, ang mga tao ay nagbibigay ng mga bagong larawan at dekorasyon upang ipagdiwang ang bagong panimula.

6. Some fruits, such as strawberries and pineapples, are naturally sweet.

7. Ang sugal ay isang laro ng pagkakataon na kadalasang nagbubunga ng pagkatalo kaysa panalo.

8. Mahigit sa walong oras siyang nagtatrabaho araw-araw upang matustusan ang kanyang mga pangangailangan.

9. Der kan være aldersbegrænsninger for at deltage i gamblingaktiviteter.

10.

11. Ailments can be acute or chronic, meaning they may last for a short period of time or a long period of time.

12. The versatility and precision of oscilloscopes make them indispensable tools for electronic design, testing, and research.

13. The United States is a leader in technology and innovation, with Silicon Valley being a hub for tech companies.

14. Puwede ba kitang yakapin?

15. Higupin natin ang gatas habang mainit pa.

16. Der er ingen fastlagte regler for, hvordan man bliver kvinde, det er en individuel proces.

17. El maíz es uno de los principales cultivos agrícolas en muchos países de América Latina.

18. Alam ko pede kang mapagkatiwalaan, Peppy. Kaya please?

19. Hindi na kasya sa silid-aralan ang mga libro kaya nagpasya ang paaralan na magkaroon ng bagong library.

20. A quien madruga, Dios le ayuda.

21. The acquired assets included several patents and trademarks.

22. Aku sangat sayang dengan kakek dan nenekku. (I deeply love my grandparents.)

23. Nagpa-photocopy ng report si Kiko.

24. Kangina pa ako nakapila rito, a.

25. Das Gewissen kann uns helfen, die Folgen unserer Handlungen besser zu verstehen.

26. Ang mga guro ng musika nagsisilbi upang maipakita ang ganda ng musika sa kanilang mga estudyante.

27. I am not exercising at the gym today.

28. Ultimately, a father is an important figure in a child's life, providing love, support, and guidance as they grow and develop into adulthood.

29. Tapos humarap sya sakin, Eh bakit ba nila ginawa yun?

30. En la realidad, las cosas no son siempre en blanco y negro.

31. Isang araw, tinikman ni Datu Duri ang isang hinog na bunga.

32. Sa mga siyudad, mahalaga rin ang mga punong-kahoy dahil nakakatulong ito sa pagpapalinis ng hangin.

33. Baka matunaw ako. biglang sabi niya. Langya gising pala!

34. Nagsisilbi siya bilang pari upang magbigay ng espirituwal na tulong sa kanyang mga parokyano.

35. Ha?! Ano ba namang tanong yan! Wala noh!

36. Sino yung naghatid sayo? biglang tanong niya.

37. Pendidikan agama merupakan bagian integral dalam kurikulum pendidikan di Indonesia, memungkinkan generasi muda untuk memahami dan menghargai agama-agama yang berbeda.

38. Sumigaw siya ng "sandali lang!" ngunit patuloy itong naglakad palayo.

39. Kailan niya kailangan ang kuwarto?

40. Sa mga agaw-buhay na pagkakataon, kailangan nating mag-isip nang mabilis at gumawa ng tamang desisyon.

41. Bilang paglilinaw, ang impormasyon ay nakuha mula sa opisyal na website, hindi sa social media.

42. May nakita umano ang mga residente na kakaibang liwanag sa kalangitan.

43. Nagkakamali tayo sapagkat tayo ay tao lamang.

44. The fashion designer showcased a series of collections, each with its own unique theme and style.

45. Nagsalita ako upang iparating ang aking pagtutol sa kanilang plano ngunit hindi nila ito pinakinggan.

46. No me gusta el picante, ¿tienes algo más suave?

47. Electric cars can help reduce dependence on foreign oil and promote energy independence.

48. I don't want to beat around the bush. I need to know the truth.

49. Maliit ang telebisyon ng ate ko.

50. She watched a series of documentaries about the history of ancient civilizations.

Recent Searches

maibalikmanananggalhigh-definitiondissekunglimitedsoundelijewritingjailhousehumabolmahahababukodpaalispangitjoedahannagdarasalnanginterestsubokumukulolumulusobjacky---binatipootpinakaindiplomanagkaganitonagiislowalessiponilihimexecutivemamamanhikankabibinasarapansamfundeffortsnatanggapfeltpumansindettegearmaibigansinapak1940saidseeneasybitawanexpandednumerosascleanmichaellegendstudiedteleviseddumiretsogenerateaddligadragongamembalopublishingreviewersmalinapakalungkotisa-isamapisisingitlutuinpasahedesigningevolvewhatsappbetweenmidterm300pinakinggantoolheftyalignsernanhulyomainstreamnagdaanstoplightreleaseddavaovirksomheder,sulatmarchantpinataymagworknakapanghihinahistorythumbslangisemnerkinahuhumalingandalinagpabakunapagpapakalatnakakapanimbangnagmasid-masidgirlfriendmatatalomahulogmakasahodmalusoginaasahannalalaglagmakinangluhahiramin,nanditopang-isahangnakonsiyensyashoesliablepulang-pulapagtayoyumanigmaghanapnagpalitbehindangkingbituinnangangalogmarahilnag-ugatalampaghugospageantmalulungkotmasayahinendsariwacorporationisinagotsarapnizburolkaniladomingoipinagdiriwangmakatiyakkastilapinagtulakanlalamunannanagsiyentosnandoongaanopinakalutangpatingikinuwentonagigingginaganapnagngingit-ngitnaisipchunnagdaraansalubongbunsokaraokemismonaghihikabkinaiinisanbestidohahanapinlinggopermitenumabognangalaglaggrammarfitnaalalakakayurinpananimtaposkapemaalalawariisaumaasahinahangaanmatariknaputolpadertawadseasontvslaylayeducatingtumambadtinaga