Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Nawala yung antok ko. May pumasok na evil plan sa utak ko.

2. She enjoys cooking a variety of dishes from different cultures.

3. Ang kabayanihan ni Rizal ay patuloy na pinararangalan sa pamamagitan ng pagdiriwang ng kanyang kaarawan at mga aktibidad sa buong bansa.

4. The Angkor Wat temple complex in Cambodia is a magnificent wonder of ancient Khmer architecture.

5. Akala ko nung una.

6. A picture is worth 1000 words

7. Ilang oras na ang nakalipas ngunit hindi pa nauwi ang batang si Ana, nagpatulong na si Aling Rosa sa mga kapit-bahay na hanapin si Ana.

8. Some countries have abolished the monarchy, while others continue to have kings or other types of monarchs.

9. Ang mga bayani ay nagturo sa mga kabataan ng mga aral at kahalagahan ng pagsisilbi sa bayan.

10. Habang naglalaba, napadungaw siya sa labas at napansin ang magandang paglubog ng araw.

11. Ate Annika naman eh, gusto ko ng toy!

12. Ang tagumpay ng kanilang proyekto ay lubos na ikinagagalak ng kanilang grupo.

13. Napatayo si Magda sa bangka, dahil alam niyang hindi marunong lumangoy ang dalawang bata.

14. Nagdadasal ang mga residente para sa ulan upang matapos na ang tagtuyot.

15. Mathematical formulas and equations are used to express relationships and patterns.

16. Sa harapan niya piniling magdaan.

17. Chester A. Arthur, the twenty-first president of the United States, served from 1881 to 1885 and signed the Pendleton Civil Service Reform Act.

18. Umupo kaya kayong dalawa! sabi sa amin ni Kriska

19. Talaga ba Sharmaine?

20. It was founded by Jeff Bezos in 1994.

21. Ang sugal ay isang aktibidad na nasa ilalim ng panganib ng pagkakaroon ng adiksyon at mental na kalusugan.

22. Maraming mga tao ang nakatambay pa rin sa mga tindahan sa hatinggabi.

23. She has been making jewelry for years.

24. Isang beses naman ay ang sandok ang hinahanap.

25. Ang panayam sa radyo ay ukol kay Doktor Jose Rizal na tumulong sa mahihirap.

26. Las escuelas tienen un impacto significativo en el desarrollo de los estudiantes y su futuro éxito en la vida.

27. Diyos ko, ano po itong nangyayari sa aming anak?

28. Sweetness can be enjoyed in moderation as part of a balanced and healthy diet.

29. At hindi papayag ang pusong ito.

30. Ang department of education ay nabigyan ng malaking pondo ngayong taon.

31. Palibhasa ay may malalim na pag-unawa sa mga komplikadong konsepto at ideya.

32. Hindi dapat tayo magbulag-bulagan sa mga insidente ng abuso sa ating paligid.

33. But the point is that research in the field of the development of new energy sources must be carried on further and expedited so that the exhaustion of conventional sources of power does not adversely affect the growth of our economy and the progress of civilization

34. Sa Pilipinas, ang tag-ulan ay kadalasang nagsisimula mula Hunyo hanggang Nobyembre.

35. Ayaw niya ng mga maarteng bagay kaya hindi siya mahilig sa mga mamahaling gamit.

36. Thomas Jefferson, the third president of the United States, served from 1801 to 1809 and was the principal author of the Declaration of Independence.

37. Napadungaw siya sa kanyang cellphone at napansin na mayroon siyang mga hindi pa nabasang mensahe.

38. Sa bawat pagsubok, si Hidilyn Diaz ay laging naniniwala na ang pagsisikap ay susi sa tagumpay.

39. Baka makatatlo pa ang kanyang nanay ngayon!

40. Ang pag-asa ay nagbibigay ng motibasyon sa mga tao upang magpatuloy sa kanilang mga pangarap at mga layunin sa buhay.

41. Nakita kita sa isang magasin.

42. Kung anu ano ang kanilang pinag-usapan hanggang sa bigla na lang napabalikwas ang prinsipe na tila ba may tumawag sa kanya.

43. Ang digmaan ay isang matinding kaguluhan sa lipunan at pangkalahatang kapaligiran.

44. The traffic on social media posts spiked after the news went viral.

45. Kapag hindi ka tumigil sa paggamit ng droga, magdudulot ito ng mas malalang kahihinatnan sa hinaharap.

46. Seperti katak dalam tempurung.

47. Hindi mapigilan ang panaghoy ng binata nang mabasa ang liham ng kanyang mahal.

48. Bakit niya gustong magpahaba ng buhok?

49. The professor delivered a series of lectures on the subject of neuroscience.

50. Limitations can be a source of motivation to push oneself to achieve more.

Recent Searches

lumabashigh-definitionnatupadhardnowmalayongpresyoprobablementenotebooklangawnabanggabipolarpunomagpapakabaitmuchosmakatarungangnetogatassakimmatatagnapapansinkamatispaaralangivelinyamonsignorkungawaretitiratheirmiyerkolesmessageblognapapahintotulungannaghandapagbigyanmagpapaikotsumusulatkatagangcomunescafeterianalungkotbackpackmarahangmasokbitbityaripeppynapahintomerchandisepinakamatabanginiwanpirasokaedadnagkasunoghalatangsinceadikkaano-anokumaripasmuntingnapakaningningmagtagotrenpinagkakaabalahanpakinabangangawingattorneyhiniritvideopinapasayanagtakapepepagawainambadulotkabinataansusulitnahintakutanlupaloppalabasanimdawpapuntangapatpropensobalotanotherna-suwaymananagotarawsay,connectingflyvemaskinerhinahanapedit:kilongaddress1935larawantaosiiwansigpongbirthdaybukastangkatinikmanstoplightpinggansignalkayalapatsumakayaga-agapakiramdampag-aaralpag-aralingantingproducts:dincheckslugawpinaladinomitsuranagpakilalaphonekupasingsisternatatawakauripansitsanaypagluluksanagsalitaotraspamagatharmfulpakealamanminatamiskasamaantulisang-dagatmagmuladahilsumindimetoderborgereiintayinleytemabangotinungodyanprinsipenanayhandanagtatanghaliannunomaglinispabalingatpayapangdumiretsoniyoipinadalabutterflylargerrecentlintanapilianalysemaliksisugatlunasginaganapanghelherramientasspiritualmagbakasyonpagtatanghalpagpapakilalainferioresmahinautoskuryentepagkamanghanamilipitkaramihanumaagospakialammaka-alisbathalamalasutlapinapanoodiyomatindingginhawamarahanlihimmayabang