Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Umikot ka sa Quezon Memorial Circle.

2. He has bought a new car.

3. Pinagpalaluan ang Kanyang karunungan.

4. Sambit ng prinsipe habang hinahaplos ang pisngi ng iniirog.

5. The ad might say "free," but there's no such thing as a free lunch in the business world.

6. Nagpakilala ang binata bilang isang prinsipe ng isang malayo at kaibang kaharian.

7. Ngumiti siya ng malapad sabay hagikgik.

8. Ang paglapastangan sa mga karapatan ng mga katutubo ay nagpapakita ng di-pagkakapantay-pantay sa lipunan.

9. Les enseignants doivent planifier leurs cours en fonction des objectifs d'apprentissage.

10. I love you so much.

11. Hindi natin kara-karaka madadala ito nang walang ebidensya.

12. The restaurant was full, and therefore we had to wait for a table.

13. Ang sabi naman ni Bereti ay naiinggit kay Karing dahil marami itong bagay na nararanasan na hindi niya nararanasan.

14. Bagaimanakah kabarmu hari ini? (How are you today?)

15. The store was closed, and therefore we had to come back later.

16. Fødslen kan føre til forskellige fysiske forandringer i kroppen, og genopretningstiden varierer fra person til person.

17. Nang tumunog ang alarma, kumaripas ng takbo ang mga tao palabas ng gusali.

18. Give someone the cold shoulder

19. Maarte siya sa mga klaseng pagkain kaya hindi siya nakikisabay sa mga inuman sessions.

20. Hindi dapat natin husgahan agad ang mga taong bukas palad sa kanilang buhay dahil baka sila pa ang tunay na maligaya.

21. La falta de recursos económicos hace que sea difícil para las personas pobres salir adelante.

22. Ang librong ito ay ukol kay mam Luisa na nagbigay inspirasyon sa kanyang mga estudyante.

23. Ang tag-ulan ay nagdadala ng mga pagsubok sa mga nag-aaral dahil sa pagkansela ng klase dahil sa malakas na ulan.

24. Bumuga na lang ng hangin si Maico saka tumingin kay Mica.

25. Ang bawat tao ay may natatanging abilidad na nagbibigay kahulugan sa kanilang buhay.

26. Habang nag-oorasyon nagising si Mang Kandoy dahil sa mga bulong ng salamangkera.

27. Imulat ang isipan sa mga kulay ng buhay.

28. Muntikan na syang mapahamak.

29. Ang diploma ay isang sertipiko o gawa na inisyu ng isang institusyong pang-edukasyon

30. Dito ang mga lalaki at doon ang mga babae.

31. Hindi maganda na supilin ang kalayaan ng mga mamamahayag sa bansa.

32. Hindi dapat tayo magpaplastikan dahil mas makakabuti kung magiging totoo tayo sa isa't isa.

33. Si Rizal ay kilala rin sa kanyang pagmamahal sa kanyang bansa at sa kanyang mga kababayan.

34. Bagamat modernong panahon na, marami pa rin ang pumupunta sa albularyo sa kanilang lugar.

35. Ang taong lulong sa droga ay parang nasasakal na kaluluwa na patuloy na hinahanap ang paraan para lumaya.

36. Tila bakal na kumakapit ang mga kamay.

37. Pangako ng prinsipe kay Mariang maganda.

38. Electric cars, also known as electric vehicles (EVs), use electricity as their primary source of power instead of gasoline.

39. Ang mga paputok at pailaw ay karaniwang bahagi ng pagdiriwang ng Chinese New Year.

40. Jagiya? hinde parin siya umiimik, Ya Kenji.

41. Es importante reconocer los derechos y la dignidad de todas las personas, incluidas las personas pobres.

42. Ngunit hindi inaasahang ang dadalaw pala sa kanya ay ang kanyang ama

43. I have a tradition of taking a photo every year on my birthday to document how I've changed over time.

44. Pumunta si Clara sa bahay ni Maria.

45. The bakery specializes in creating custom-designed cakes for special occasions.

46. Ang aming kaharian ay hindi kayang marating ng taong may katawang lupa.

47. La amistad entre ellos se fortaleció después de pasar por una experiencia difícil.

48. Efter fødslen kan der være en følelse af lettelse og glæde over at have en ny baby.

49. Pnilit niyang supilin ang hangaring makasilong.

50. Los powerbanks también son útiles para actividades al aire libre, como acampar o hacer senderismo, donde no hay acceso a la electricidad.

Recent Searches

carbonpulisdikyamhigh-definitionskyldeskalongwaterhundredtoretekabosesalaalasuotxixalexanderdiagnosesopokumukulocomputere,bingisnobanimoymanuscriptsenatewalngadverseinantoktinanggaphusopangingimiusowatchmayamanfaketrafficdinalawshortlimoscontestulambilinipagbiliwestorugaperatanodprivateellenworryeveningagilityipinikitlaterinalokeeeehhhhrestawaninfluencecrazybadinganimdulanaggingpopulationipinasagingdecisionshithmmmincludetopicefficientilinginaapipasinghalinteligentesandynariningcontentcareerlot,nalagutanwriting,generationsmaligayalinggopangangatawanadaptabilityworkdaymakapangyarihanmadridpassworddali-daligardenloobmaistorbopumatolnagpalutoumiibigcoatnaawapagkatjudicialmurangmotorkanilanggisingpaghangapangungutyaikinatuwacountlesssaranggolamarketplacesngayonkinakabahanpaglakipinagmamasdantumawagpinahalatamasayahinpearlpaghalakhakvirksomhederfotoskagalakaninordernagpapakainmalulungkotmagpasalamatcorporationnakalockjejuguitarranovellesnakikitangsagasaansarappinuntahankumikilosnagdiretsolargeimpactedhalagadadalawculturaslumabasibinaonhinahanapcultureshigantenakangisingpapuntangika-12kangitanna-curiouspapalapitgovernorsbayanipinabulaantinatanongfreedomsibiliiniangatkulisappalayogjorttalagaenergydiapercashtanawdomingokargangnanayplagaskirotlistahannaglababigyanseniormalambingtambayananywherelandetsecitizensipatshirtmarteskatedralpangitfionaibonseriousbagyogearkakatapostaposeffortsdagabriefoverall