Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Hindi lang militar ang nakikinabang sa digmaan, maaari rin itong magbigay ng oportunidad sa mga negosyante.

2. Der er mange forskellige former for motion, herunder aerob træning, styrketræning og fleksibilitetstræning.

3. The legislative branch, represented by the US

4. Ayaw niyang kumampi sa matatalo kung kaya't ang ginawa niya ay nagmasid-masid muna ito sa di kalayuan at pinanood ang nagaganap na labanan.

5. Patients and their families may need to coordinate with healthcare providers, insurance companies, and other organizations during hospitalization.

6. Las hierbas frescas añaden un toque de color y sabor a las ensaladas.

7. Where there's smoke, there's fire.

8. Ang mga punong-kahoy ay kadalasang tinatanim bilang mga pampaganda sa mga pampublikong lugar tulad ng parke o plaza.

9. Eh gaga ka pala eh, gag show mo mukha mo.

10. Sa sobrang lamig ng tubig, hindi ko magawang salatin ito nang matagal.

11. Nakapag-travel ako sa ibang bansa kaya masayang-masaya ako ngayon.

12. Laging pinapasaya ni Nicolas si Helena kaya tuwang tuwa ang mga magulang nito sa kanya, itinuring na siyang kapamilya ng mga ito

13. The Hollywood Bowl is an iconic outdoor amphitheater that hosts concerts and live performances.

14. Hinde sa ayaw ko.. hinde ko lang kaya..

15. The culprit behind the cyberattack on the company's servers was traced back to a foreign country.

16. Kahit saan man ako magpunta, hindi ko makakalimutan ang aking kaulayaw.

17. Dancing all night at the club left me feeling euphoric and full of energy.

18. Ang buntot ng saranggola ay mahaba at makulay.

19. La science environnementale étudie les effets de l'activité humaine sur l'environnement.

20. The cake is still warm from the oven.

21. Limitations can be viewed as opportunities for growth and personal development.

22. Palaging nagtatampo si Arthur.

23. Hindi ako makapaniwala na datapapwat ay nangyari ang ganitong kaguluhan sa aming lugar.

24. Sa lahat ng bagay, mahalaga ang tamang panahon.

25. I saw a pretty lady at the restaurant last night, but I was too shy to talk to her.

26. Fødslen kan også være en tid til at forbinde med ens partner og skabe en dybere forståelse og respekt for hinanden.

27. Ang mga hayop sa gubat ay naglipana din.

28. Accepting the job offer without reading the contract was a risky decision.

29. Noong una ho akong magbakasyon dito.

30. Les médicaments peuvent aider à traiter de nombreuses maladies, mais doivent être utilisés avec précaution.

31. Waring hindi pa tapos ang laban, kaya hindi kami dapat magpabaya.

32. Naglalaba siya ng mga kumot at kurtina upang mapanatili ang kalinisan ng aming tahanan.

33. Anong karangalan ang ibinigay sa kanya?

34. Babalik ka pa ba? nanginginig na yung boses niya

35. The athlete completed a series of intense workouts to prepare for the competition.

36. Siempre es gratificante cosechar las verduras que hemos cultivado con tanto esfuerzo.

37. Pupunta si Mario sa tabing-dagat sa hapon.

38. Ang kulay asul na saranggola ay sumayaw sa bughaw na langit.

39. "Dogs are not our whole life, but they make our lives whole."

40. Ano ang dapat gawin ng pamahalaan?

41. Naging espesyal ang gabi ng pamamamanhikan dahil sa pagtutulungan ng dalawang pamilya para sa nalalapit na kasal.

42. Berapa harganya? - How much does it cost?

43. Ang aking mga kaulayaw sa simbahan ay naging mahalagang bahagi ng aking buhay.

44. At leve med en tung samvittighed kan føre til søvnløshed og andre sundhedsproblemer.

45. Kapag ako'y nag-iisip nang maayos at walang stress, ako'y nakakamit ng isang matiwasay na pag-iisip.

46. Palibhasa hindi niya kasi malaman kung mahahanay ba siya na isang mabangis na hayop o di kaya'y ibon.

47. El expresionismo es un estilo de pintura que busca transmitir emociones intensas.

48. Inalok niya akong sumama sa kanyang outing, datapwat may iba akong plano para sa araw na iyon.

49. Bruce Lee was a martial artist, actor, and philosopher who is widely considered to be one of the most influential figures in the history of martial arts

50. Nasa Canada si Trina sa Mayo.

Recent Searches

lumilingonnoonmatulishigh-definitionknightwatertamaanihinreviewkuwebamaistorboheartbreakbinanggaparehashoymaliitchumochosmimosabotebabeskotsengcollectionsboboconectadospostcardchoiceuncheckedsaanstillbuwanilangsenatewordconsistfiabecomenanghuhuliseguridadsantogivebiluganghojaswarigrammarsigalintacomunicanindustrymagtipidconsumeadoptedbestpalaytitigillaylaydahonluispupuntapalagingsciencekumaripaspetsaoncedesdechangelorilabanlabingbuwalseparationanumangapomotionevendigitalanimviewsmichaelmaramimarkedtrainingschoolfatalgeneratebosestrueisladidingtopic,existbalahibosamalightsmangetumatawadcomienzannglalabasalbahetumiraperformancecoughingeyaninongbinibinipaalammasayang-masayachoienhedernangangalitsinumangnoblepamilyafuturesueloechavepananghaliannalugmokelectionsboyetpagtutoljuegosmagkaibapinagmamalakimatabaomelettelikesnagkumulogkalalakihanmaglaromaabutanmagsalitabalangpaghaliknobodyfallnecesarionangapatdanmagtanimbukodeksperimenteringwhiletonightopisinahamonbluesabinakakulongnakauslingphilippineinangmagamotampliatanawkamustadumilimaregladoestudiosmallbumibilidyipnirepresentativeguiltysatisfactionnangyayaricommunicateextraisinarapagkakalutonanghihinanakaluhodnalulungkotnakikini-kinitamakikipag-duetogrocerymalihisparkenapatinginnuhnagisingcarbonfitsusifulfillinglayastulisanmatagalsanaykasawiang-paladknowssumalilabaspicslatestcafeteriafrahallofficeeskuwelanagsagawa