Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Mayroon pa ho sana akong gustong itanong.

2. Many people turn to God for guidance, comfort, and solace during difficult times in their lives.

3. It's important to maintain a good credit score for future financial opportunities.

4. Mag asawa na kayo pero hindi mo pa nasasabing mahal mo siya?

5. Hindi nakagalaw si Matesa.

6.

7. Many people experience stress or burnout from overworking or job dissatisfaction.

8. Malinis ang kuwarto ng mga magulang ko.

9. Ang digmaan ay maaaring magdulot ng pagbabago sa relasyon ng mga bansa sa isa't isa.

10. Hospitalization can be expensive, and patients may be responsible for paying for medical bills and other associated costs.

11. Ano ang ginagawa mo nang lumindol?

12. La pintura al óleo es una técnica clásica que utiliza pigmentos mezclados con aceite.

13. We need to optimize our website for mobile devices to improve user experience.

14. Sa larong volleyball, ipinasa ni Liza ang bola sa kanyang kakampi.

15. They admire the way their boss manages the company with fairness and efficiency.

16. Nag-aaral ang estudyante sa laybrari.

17. Lazada has partnered with government agencies and NGOs to provide aid and support during natural disasters and emergencies.

18. Sa gitna ng galit at poot, nahihirapan akong makapagpatuloy sa aking buhay.

19. Snow White is a story about a princess who takes refuge in a cottage with seven dwarfs after her stepmother tries to harm her.

20. Hinahabol ko ang aking hiningang mahina dahil sa kalagitnaan ng marathon.

21. Nagbigay ng pahayag ang alkalde ukol kay Maria tungkol sa mga plano para sa lungsod.

22. The information might be outdated, so take it with a grain of salt and check for more recent sources.

23. Pumunta kami sa Laguna kamakalawa.

24. It's important to be realistic about your expectations and to choose a strategy that aligns with your skills and interests

25. Pakibigay sa driver ang bayad ko sa pamasahe, wala akong abot.

26. Les écoles offrent des bourses pour aider les étudiants à payer leurs frais de scolarité.

27. Panay pa ang post nito sa facebook ng bagong damit eh hiram lang naman nya ang lahat nang yun.

28. Hindi pa namin napapag-usapan eh. sagot niya.

29. Pwede mo ba akong tulungan?

30. Bakit siya pa yung kelangan mong pahirapan?

31. The company decided to avoid the risky venture and focus on safer options.

32. Nakakatulong ang paghinga ng malalim at pagsisimula ng halinghing para sa relaxation.

33. The internet has also led to the rise of streaming services, allowing people to access a wide variety of movies, TV shows, and music

34. Cut to the chase

35. Les systèmes de recommandation d'intelligence artificielle peuvent aider à recommander des produits et des services aux clients.

36. Mahal ko iyong dinggin.

37. Si prince charming yan noh? pang-aasar ko.

38. Labis kang nasugatan, mabuti pa siguro ay sumama ka sa akin upang magamot ng aking asawa ang iyong mga sugat.

39. Magandang umaga naman, Pedro.

40. Inakalang madali lang ang gawain, pero ito’y masalimuot pala.

41. Magdamagan ang trabaho nila sa call center.

42.

43. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

44. Sa bawat pagkakamali, mayroong aral na pwedeng matutunan, samakatuwid.

45. Doa juga bisa dianggap sebagai bentuk ungkapan syukur atas nikmat dan karunia yang diberikan Tuhan.

46. He likes to read books before bed.

47. Nagpapalabas ng horror movie ang TV network ngayong hatinggabi.

48. Jeg har aldrig mødt en så fascinerende dame før. (I have never met such a fascinating lady before.)

49. Ang pag-asa ay nagbibigay ng mga oportunidad sa mga tao upang magpakatotoo at magpakabuti.

50. Dahil sa biglaang trapik, na-late ako sa meeting ko kanina.

Recent Searches

naglabananginaganoonhigh-definitionaywanilangbaterya1940salasinunodnetoresortmayroonmeaningtseailmentsaabotvalleyonlinenagreplyipinabalikshowitakbipolartenso-calledsinipangmasdanleyteartskabibiaccederaumentarpagtuturoitinuturonagturopag-akyatmadilimturomagdidiskomagsisinemagsayangmagdalamagsubomaglutomagpapalitmagtrabahomagpahingagreenhillsmagigingmagulangmag-uusapmag-galamagka-babymag-ordermagsasamamag-ibamagpa-paskomagbalikmagtatampomagandamag-usaprestawransumahodsouthmagkinakaligligmahiliglaway1787kalawangingkamakalawadalawangmatakawpaguutosmagingpaghusayanminsanbumababamabangisculturalbihirangcedulanatalolawamakahihigitscaleoffentligeinyongnamangnagbantaynagdaoscigarettesmagasawangsocietyngpuntabagkasireadnatatangingbigkismakatawabroadcastpagkakamalimahabarelativelybuwisbestmagaling-galingenergilabiskongiyonpresencesilanggenerositysertuladgawinkatutubotinuturokutsilyonapapahintobuwalmagtiwalatindamatandangyourself,ganitokomunikasyonkakilalaamendmentmarketing:facemaskagilityhapag-kainanadicionalesigigiitpagpuntapag-isipandamitperseverance,contentpumuslitnapangitibangkomag-asawangnakangitingalas-doseipagtimplaairporthiyaminamahalhapunantanyagharingdagokcomputerhanggangkelanganikinatuwawalangmaisnakalimutanwalapopularizekalimutanmatutulogimportantpalitanhumahagokrealisticmidtermpalibhasakulisapgabrielipapainitnapilitanpopularbiglangpalabasdefinitivoatagiliranrecentlyreallywatchingemphasisinatupaghulingmulingnahintakutanmalayangfoundmaarawrealaraw-arawkuwentokaarawan,durasalistmica