Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Palibhasa ay mahusay sa paglutas ng mga komplikadong mga teknikal na problema.

2. For doing their workday in and day out the machines need a constant supply of energy without which they would come to a halt

3. Nanlilimahid ang mga bata sa daan.

4. Itinapon nina Fred at Melvin ang basura

5. Leukemia can be cured in some cases, but long-term monitoring is necessary to prevent relapse.

6. His administration pursued a more confrontational stance towards countries like China and Iran.

7. Hindi ko alam kung nagbibiro siya.

8. Los efectos a largo plazo del uso de drogas pueden ser irreversibles.

9. Siya ay nanalangin para sa kaluluwa ng kanyang yumaong kaibigan upang ito'y makalaya na mula sa purgatoryo.

10. This can include creating a website or social media presence, reaching out to book reviewers and bloggers, and participating in book signings and events

11. Miss, nakalabas na ba yung pasiyente dito?

12. Mabuti naman at nakarating na kayo.

13. The eggs are beaten until the yolks and whites are well combined.

14. A couple of goals scored by the team secured their victory.

15. Isinalaysay niya ang pagkapasan sa krus upang iligtas lamang ni Hesus ang mga makasalanang tao sa daigdig.

16. Bukas na lang ako pupunta sa bangko.

17. Hospitalization can range from a few hours to several days or weeks, depending on the nature and severity of the condition.

18. Las escuelas también pueden tener una biblioteca y recursos educativos en línea para los estudiantes.

19. Las labradoras son una raza de perros muy populares en todo el mundo.

20. El puntillismo es una técnica de pintura que utiliza pequeños puntos de color para crear la imagen final.

21. I am not reading a book at this time.

22. Samantala sa pagtutok sa kanyang mga pangarap, hindi siya nagpapatinag sa mga hamon ng buhay.

23. Basketball players are known for their athletic abilities and physical prowess, as well as their teamwork and sportsmanship.

24. Kumain ako ng macadamia nuts.

25. Matagal akong nag stay sa library.

26. Gusting-gusto ng kanyang magtatapos na anak ang minatamis na garbansos.

27. A palabras necias, oídos sordos. - Don't listen to foolish words.

28. They must maintain transparency and communicate with their constituents to build trust and ensure representation is effective.

29. All these years, I have been creating memories that will last a lifetime.

30. Digital microscopes can capture images and video of small objects, allowing for easy sharing and analysis.

31. Cancer treatment can have side effects, such as nausea, hair loss, and weakened immune system.

32. Hindi maikubli ang panaghoy ng bata habang nilalapatan ng lunas ang sugat niya.

33. Hindi lahat puwede pumunta bukas.

34. Nagtatanim ako ng mga bulaklak sa mga paso upang magkaroon ng mga colorful na dekorasyon sa loob ng bahay.

35. Ang pagsisindi ng kandila tuwing gabi ay naging isang ritwal na nagbibigay ng katahimikan sa kanyang isip.

36. Cada nacimiento es un milagro y un regalo especial.

37. Mabuti pa makatayo na at makapaghilamos na.

38. Kung ano ang puno, siya ang bunga.

39. Te llamaré esta noche para saber cómo estás, cuídate mucho mientras tanto.

40. Lumiwanag ang silangan sa pagsikat ng araw.

41. Pinagsisihan niya ang mga desisyon na hinugot niya mula sa kanyang emosyon.

42. The dedication of mentors and role models can positively influence and shape the lives of others.

43. Nakasuot siya ng damit na pambahay.

44. La voiture rouge est à vendre.

45. En algunos países, el Día de San Valentín se celebra como el Día del Amigo.

46. Les hôpitaux sont des lieux où les patients peuvent recevoir des soins spécialisés.

47. Ketika menghadapi tantangan hidup, penting untuk menjaga keseimbangan antara kerja keras dan istirahat yang cukup.

48. Hindi masikmura ni Lando ang ginawang kasamaan ng kanyang kaibigan.

49. Elektronikken i en bil kan hjælpe med at forbedre kørsel og sikkerhed.

50. Kapag mayroong hindi malinaw na impormasyon, madalas na nagkakaroon ng agam-agam sa mga tao.

Recent Searches

alakhigh-definitionlongreorganizingalexanderingatanbowkaklasepamagatiyongdiretsahangmagalitrecentlybuseveningbitawannagitlakirbystyleyepmainitnitongmanggagalingmaghugasbefolkningen,kahapongoodtahimikdumilatmangkukulamwesleynagulatkausapinmarvindrinkspinakaninklimapampagandagagamitlibertarianlimangnararapatipinatawgraceparomarasiganlumingonviolencegenerationernagwagimasasayapakakatandaannakabawimagdoorbellgumagamitkinahacerkakayanangkanilatmicacaraballovariousmisalargerhingalseesinapakbabesmaluwangmahahabaamparonakasandigbloggers,nalalaglagmeriendapagkuwapunung-punogabi-gabimagkakaroonhitananlalamigmagpakasalpagpanhiknagnakawkahilinganpaghihirapteachermaghahabifysik,arbularyoistasyonapollomahinapagkaraaseguridadnaglaoncompaniespaostumigilnasagutannagbibiropaidanijeepneynagwalishabitsafternoonnatitiyakrodonaempresaselenapananakitrewardinghirampagongattorneyiniirogbefolkningengrammarvegasobservation,pakibigaygirayfreedomskaraokekonsyertolingidoutlinelipadlumilingonjocelynambagnetflixtransportationnahawakargangpalapitsuccessfulscottishjoepancitresumenkinsepakealammananaogpinangaralansinabisumarapdatibilluncheckedamongvideotryghedspatabasatafiguresmalapitmacadamiamagbungaprogramaestablishedcreatingipinaliteasyresourcesbehalfcleanwhichawtoritadongmakakakainunankagabisumalinapakagandaisusuotmensajesdownsabongimportanteromanticismogobernadorbinabadagatanimanspecialmahihiraplungsodnangangalitlumusobsinceupomasungitmagsusuotmanggamismonagbuwismagsi-skiing