Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Being aware of our own emotions and recognizing when we are becoming frustrated can help us manage it better.

2. Waring nag-aalangan siyang pumasok sa silid dahil sa takot.

3. Guarda las semillas para plantar el próximo año

4. No puedo comer comida picante, me irrita el estómago.

5. Wala ho akong dinukot na maski ano sa kanya.

6. Isang Saglit lang po.

7. Walang tigil sa paghalakhak ang matanda mula sa kanyang kinatatayuan.

8. Nagtatampo na ako sa iyo.

9. Nagkaroon ng malubhang aksidente sa konstruksyon kung saan namatay ang ilang manggagawa.

10. Magtanim na lang tayo ng puno para makatulong sa kalikasan.

11. But the point is that research in the field of the development of new energy sources must be carried on further and expedited so that the exhaustion of conventional sources of power does not adversely affect the growth of our economy and the progress of civilization

12. Sa tradisyon ng kanilang kultura, isang malaking kaganapan ang pagpapakilala ng pamilya ng lalaki sa pamilya ng babae sa pamamamanhikan.

13. Habang tumatakbo siya, tila lalong palayo ang kanyang mga pangarap.

14. Napapikit ako sa takot nang biglang nagitla ang bubong dahil sa malakas na ulan.

15. Ikinakagalit ko ang mga sakim na minahan.

16. A picture is worth 1000 words

17. Ang calcium ay kailangan ng ating katawan upang tumibay pa ang buto.

18. Nangyari ang isang malaking proyekto sa aming lugar dahil sa bayanihan ng mga residente.

19. To: Beast Yung friend kong si Mica.

20. Kumaripas ng takbo ang aso nang makita ang paparating na sasakyan.

21. Sobrang mahal ng cellphone ni Joseph.

22. Walang pagtutol sa mga mata ng mga ito.

23. Ang batang matuto, sana sa matanda nagmula.

24. Ang mga pangarap ay nakakapagbigay sa atin ng determinasyon at inspirasyon upang magpatuloy.

25. The website's security features are top-notch, ensuring that user data is protected from cyber attacks.

26. Ang tag-ulan ay nagdadala ng mga pagsubok sa mga nag-aaral dahil sa pagkansela ng klase dahil sa malakas na ulan.

27. Las escuelas pueden ofrecer programas de intercambio estudiantil para estudiantes internacionales.

28. Sa mga sitwasyon ng buhay, ang mailap na oportunidad ay kailangan mabilis na kinukuha.

29. Gusto nilang sumakay ng dyipni sa Pilipinas.

30. The car might look old, but you can't judge a book by its cover - it's been well-maintained and runs smoothly.

31. Financial literacy, or the understanding of basic financial concepts and practices, is important for making informed decisions related to money.

32. Limitations are the boundaries or constraints that restrict what one can or cannot do.

33. Pagkatapos ay abut-abot ang kanyang paghingi ng paumanhin sa mga duwende.

34. Magsasalita pa sana siya nang biglang may dumating.

35. A caballo regalado no se le mira el dentado.

36. Ketika menghadapi tantangan hidup, penting untuk menjaga keseimbangan antara kerja keras dan istirahat yang cukup.

37. The task of organizing the event was quite hefty, but we managed to pull it off.

38. Mayroon ba kayong reaksiyon, Senador Ferrer?

39. Hala, change partner na. Ang bilis naman.

40. Tumagal ng ilang minuto bago natapos ang palabas.

41. Satu titik hitam bisa merusak noda yang putih.

42. Tumango ako, you want? alok ko sa kanya.

43. Las pitones y las boas constrictoras son serpientes que envuelven a sus presas y las aprietan hasta asfixiarlas.

44. Algunos powerbanks tienen múltiples puertos USB para cargar varios dispositivos al mismo tiempo.

45. Marami sa atin ang may mga pangarap sa buhay na nais nating tuparin.

46. Itinali ng hari ang batang higante at pinakawalan ang mga taong nakakulong sa kuweba.

47. El cultivo hidropónico permite el crecimiento de plantas sin utilizar suelo.

48. Iron Man wears a suit of armor equipped with advanced technology and weaponry.

49. Masaya ako dahil mayroon akong kaulayaw sa buhay.

50. Parang itinulos sa pagkakatayo ang mag-asawa at di malaman ang gagawin.

Recent Searches

rosellemarmainghigh-definitionenergibangkorestaurantninongcharismaticpaskoconservatoriosseedalandannilinisdalawbusyangbatayscientificcollectionscupidbecomecentergisingorugashowstakesconsistswimmingumikoteditordevelopedimaginationsuelosorryknowspingganso-calledloriagadalioutlinesbinabalikmegetatentofuryfireworksnewwealthheilivechambersencounterharinutrientestransitshockpinunitstrengthrichbumugagameyoungeveningchefdoonbehalfinspiredeasytalehelpfulsingerexpectationsstudentskarnabalconsideraralinlightssedentaryvasquesmethodsmakapilingincludestatingtechnologicalipinalitvanstyrerwaitattackthemdebatesmaputigenerabaconsiderroquepatience,drewbossmakikikainnagkalapitsultansportsmasikmuraandrewsalekapangyarihangaanhinnagkapilatbumisitademocracynawalangpronounpagsambanaulinigansiksikannaglarosamakatwidkalalaroikukumparaaalismagkasakitpumayagnaghilamosskirtmerlindaanibersaryotatagalpakanta-kantaumiinombeautypakakatandaanmahiyakasintahanawtoritadongkagipitanmasasayasampungtatlomananaloperpektingcompaniesmasagananglumusobnaiinisiikutancombatirlas,mahabolbayadpagdiriwangnagwalistinanggalbirthdaymaaksidentekalaroakmangisinamabalik-tanawginawarankumainfollowedmanalogrocerynuhbisigtoothbrushnahulipinapakiramdamandalawangpunohihigitatensyoncarboncrucialmakasilongnanlakinaguguluhanphilanthropymahinangunattendedinvestingsasagutinmagkapatidflyvemaskinerlikurannaghihirapkinalalagyanlalabhanmagkasamapawiinpaglalabakuryenteinabutanadgangnakakamitmedikaleskwelahanikinalulungkotpagkakatayonagsisipag-uwiannagpapaniwalabarung-barong