Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Ang mailap na kaharian ay kailangan paghirapan upang mapasakamay.

2. Ang paglabas sa kalikasan at pagmamasid sa magandang tanawin ay nagpapalakas sa aking loob at nagbibigay ng isang matiwasay na kalagayan.

3. Nahigitan na nito ang kakayanan ng kanyang ama at ina.

4. Hindi ako mahilig kumain ng pulotgata dahil sa sobrang tamis nito.

5. It's never a good idea to let the cat out of the bag when it comes to confidential information - it can have serious consequences.

6. Ariana Grande is also an advocate for mental health awareness, openly discussing her experiences with anxiety and PTSD.

7. Les sciences sociales étudient le comportement humain et la société.

8. Puwede ba bumili ng tiket dito?

9. Einstein was born in Ulm, Germany in 1879 and later emigrated to the United States during World War II.

10. Me gusta comprar chocolates en forma de corazón para mi novio en el Día de San Valentín.

11. Hindi pa ako kumakain.

12. Ang lider ng samahan ay pinagpalaluan ng mga miyembro dahil sa kanyang integridad.

13. Natawa ako sa maraming eksena ng dula.

14. Foreclosed properties may have liens or other encumbrances, which can complicate the purchase process.

15. Nagmadali kaming maglakad papalapit kay Athena at Lucas

16. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

17. Pero pag harap ko, para akong nanigas sa kinatatayuan ko.

18. Aquaman has superhuman strength and the ability to communicate with marine life.

19. Sa pagpapabuti ng bansa, dapat isipin ang kinabukasan ng mga susunod na henerasyon.

20. I heard that he's not trustworthy, so I take everything he says with a grain of salt.

21. Danske virksomheder, der eksporterer varer til USA, har en betydelig indvirkning på den amerikanske økonomi.

22. Nabagalan ako sa takbo ng programa.

23. I was going to surprise her, but I accidentally spilled the beans.

24. Mahilig siya sa pag-aaral ng mga klasikong akda ng panitikan, at ang pag-aaral na ito ay nagbibigay ng karagdagang kulay sa kanyang karanasan.

25. Hinugot niya ang kanyang puhunan sa bangko upang magtayo ng negosyo.

26. Magtanim tayo ng kabutihan sa lupa upang anihin natin sa langit.

27. Mi amigo es un excelente cocinero y siempre me invita a cenar en su casa.

28. Bigla, mula sa tubig ay isang babae ang lumutang sa hangin.

29. Mahirap kalabanin ang sakit na nagdadala ng agaw-buhay na pakikibaka.

30. Napupuno ako ng poot sa tuwing naaalala ko ang mga pagkakataon na ako'y pinagtaksilan at sinaktan.

31. Sadyang masarap ang lutong ng tinapay na ito.

32. Nandito ako sa entrance ng hotel.

33. Gumamit ang albularyo ng dahon ng bayabas upang linisin ang sugat ni Pedro.

34.

35. Pakibigyan mo ng tip ang waiter.

36. Araw-araw na bumalik ang prinsesa sa kagubatan hanggang ang bulaklak ay napalitang ng bunga.

37. Mahirap makipag-usap sa mga taong mailap at misteryoso.

38. Hun er utrolig smuk. (She is incredibly beautiful.)

39. Sa dakong huli, nakita ko ang aking kaibigan na umiiyak sa sulok ng classroom.

40. Sumakay ako ng taksi papuntang airport.

41. Sa kaibuturan ng kanyang kaluluwa, alam niyang tama ang kanyang mga desisyon.

42. Magtatapos ako ng aking thesis sa buwan na ito, datapwat kailangan kong maglaan ng mas maraming oras para dito.

43. Kebahagiaan dapat ditemukan dalam hubungan yang sehat dan penuh cinta dengan keluarga, teman, dan pasangan.

44. Nationalism has been an important factor in the formation of modern states and the boundaries between them.

45. Awang-awa ang maraming katutubo sa pagpapasan sa krus si Padre Novelles.

46. Stop crying and pull yourself together, we have work to do.

47. The use of emphasis is influenced by cultural and social norms.

48. De har gjort det muligt for os at automatisere mange af vores daglige opgaver og øge vores produktivitet

49. Nagkaroon ako ng agaw-buhay na pagkakataon na makapag-aral sa ibang bansa.

50. Joshua, kumusta ang pakiramdam mo?

Recent Searches

psssbecamejenadikyamhigh-definitionmulighedernagdaramdampitoneadiagnosticsparepopularizemodernebusiness,ramdamkrussemillasiatftanodtransmitidaslaryngitisotrastalentedofficenamipanlinissumabogscientificdagaschools1876tuwangsinunoddoktornahuliabalapintuannakakunot-noongpublishingiostakecoinbaseagosgoodataquesmainityesirogsuelobiggestonceboteriskrestawanvaccinessakupinbroadcastsbasamalakingextrabeyondmotionuponannasafeactionfluiditystudiedpeterpapuntabakevariouspaglapastanganwaternapatakboshiftmateryalesnewputingnapilingiginitgitminamasdanwindowtabaprogramming,involvestopcallingmanagerstyrerreturnednatabunanvitalsang-ayonbotongkwartosumalaaniyamangangahoynagagamitpagongcondodiscipliner,mumurakusinakingdomstarmaputlatraditionallinggo-linggonagyayangthoughtsnagtutulunganhoundinfluencesmaibaexigentemaglutomagdilimperpektolayuansumasaliwcruzkundimanbehaviorjunjunilangkaibamalapitinaabotnakapagreklamomaarawdiinkisapmatanetflixdiyanampliapronountinuturomaibigayunosexpeditedvivalapitanconsistfistscontrolanakaliliyongkumembut-kembotdi-kawasainilabassumasambapagpapasanhubad-baronakalipasalas-diyeswalkie-talkienagliliwanagnaninirahanmakikipagbabagpaghalakhakinasikasonabubuhayhinimas-himaskinakabahannagliwanagbalitasiniyasatpamahalaannakahigangkarununganopgaver,pinapatapospresidentemakabilitumahanhalu-haloinsektongnakikianagmistulangtatayokuwadernolalakadmasaganangkinalakihanisinakripisyoabut-abotdesisyonantumalimyakapinincluirumuwimungkahina-fundailmentsmaliyumaoyouthmaibibigayhanapbuhay