Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Bakit ayaw mong kumain ng saging?

2. Actions speak louder than words.

3. If you quit your job in anger, you might burn bridges with your employer and coworkers.

4. Ang yaman naman nila.

5. La adicción a las drogas puede afectar negativamente las relaciones familiares y de amistad.

6. The government is working on measures to reduce traffic pollution in urban areas.

7. Naawa naman ang pamilya kay Damaso, kaya doon na pinatira sa bahay nila ito.

8. Der er en række organisationer og programmer, der tilbyder hjælp til mennesker, der kæmper med gamblingafhængighed.

9. The French omelette is a classic version known for its smooth and silky texture.

10. Sandali lamang po.

11. Inakalang nagtatampo ang kapatid niya, pero hindi naman pala.

12. Dahil sa ugali ni Aya na hindi maganda, siya ngayon ay kinaiinisan ng mga taong dati ay sa kanya pumupuri.

13. Durante su carrera, Miguel Ángel trabajó para varios papas y líderes políticos italianos.

14. Ang gusali sa tabi ay mababa kumpara sa bagong itinayong opisina.

15. Honesty is the best policy.

16. A microscope is a device that uses lenses to magnify small objects.

17. Sa aking probinsya, tawag sa pulotgata ay "latik".

18. Lumapit ang matandang babae at ipinahayag ang kanyang hinagpis dahil sa kawalang-katarungan.

19. Nagtawanan ang mga kaibigan, waring may alam silang lihim na hindi ko nalalaman.

20. Sa buong buwan ng Disyembre, ang mga mall ay hitik sa mga pamaskong dekorasyon at mga regalo.

21. He has been gardening for hours.

22. La obra de Leonardo da Vinci es considerada una de las más importantes del Renacimiento.

23. The novel might not have an appealing cover, but you can't judge a book by its cover - it could be a great read.

24. Maaaring magbago ang pulitika ng isang bansa dahil sa digmaan.

25. Ang mga bayani ay nagpapakita ng matapang na paglaban laban sa pang-aapi at kawalang-katarungan.

26. Ang mga magsasaka ay nahihirapan sa kanilang ani dahil sa matinding tagtuyot.

27. El agua tiene propiedades únicas, como la capacidad de disolver sustancias y regular la temperatura.

28. Get your act together

29. The nature of work has evolved over time, with advances in technology and changes in the economy.

30. Good. Pahinga ka na. Dream of me. aniya.

31. Sa pagpapahalaga sa ating kalayaan, kailangan din nating bigyan ng halaga ang kalayaan ng iba.

32. Despues de cosechar, deja que el maíz se seque al sol durante unos días antes de retirar las hojas y las espigas

33. Nagbabakasyon ako tuwing Abril.

34. The wedding photographer captures important moments and memories from the wedding day.

35. Nagtatrabaho ako sa Manila Restaurant.

36. Nakaupo ang babaeng nakasuot ng salamin.

37. Mahigpit na binabantayan ng mga otoridad ang mga kilalang salarin sa lungsod.

38. Market indices such as the Dow Jones Industrial Average and S&P 500 can provide insights into market trends and investor sentiment.

39. Scientific data has helped to shape policies related to public health and safety.

40. LeBron has used his platform to advocate for social justice issues, addressing inequality and supporting initiatives to effect positive change.

41. Sorry, I didn't catch your name. May I know it again?

42. Guten Tag! - Good day!

43. Before the advent of television, people had to rely on radio, newspapers, and magazines for their news and entertainment

44. Si Ogor, Impen, pahabol na bilin ng kanyang ina.

45. Araw araw niyang dinadasal ito.

46. Kings may wield absolute or constitutional power depending on their country's system of government.

47. En España, el Día de San Valentín se celebra de manera similar al resto del mundo.

48. Ang daming linta sa bundok na kanilang inakyat.

49. Ayaw mo akong makasama ng matagal?

50. A series of earthquakes hit the region, causing widespread damage.

Recent Searches

iigiblistahankapainkuyarestaurantanihinhigh-definitionlunesmaayosyeykasuutanpagkainsoccerklasrumtanodgoshmorenaonlinehverdalagangtsakanatandaantapehiningiperabagkusmalapadearn1980sumusunomisasystematiskkadaratingisinalangbrindaradangallowingkumalantogjudicialpocadahonbeintenalasingconventionaleveninghitharidagadalandansubjectbugtongfataniplanviewsinspired1982roquebeforebulsabrideconectanimagingelectronicbehalfganapvisualsequelearnamountincreaseseitherrememberipinalitberkeleycurrentfencinginternalmalakingclubnasamahahawaprotegidogayunpamanself-defenseiniisipmagkaibigancountlessrabepataynahintakutanlaylaypshbumahanagmamadalipulubiagilityeksenaangelicadinigrelativelybadingsambitnagliliwanagkinakabahanipinansasahogpaanogalitsunud-sunurandropshipping,airplanesnababasamabangonabanggapabaliklakirenatolipadwaringalituntuninnagtatanongvistitakikawkapangyarihangtaoprotestasumisilipkatabingpaghuhugassasayawinpinahalataiyanpinabayaanfallerapbalotbangkangbintanaellaeditduondowndoonnagtakapagkabigladitokontinentengnakatuoncomocoatcashbusybulaibat-ibangbaulbatialamidbangbaitbabaasuladvertisingmatulunginalinagosnagpatuloy3hrsbelllayunin1990decreaseallowed1876kalalakihanmakikipag-duetonamulatpaghalakhakmakakawawatiniradorkapangyarihanpinagkaloobanpalipat-lipat11pmbigkisyunwowvedpabalingatunosongutomnakapasoknasasabihannagpepekenagsagawanagliwanagnapakasipagbefolkningen,nagreklamo