Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. May kailangan akong gawin bukas.

2. Anong tara na?! Hindi pa tapos ang palabas.

3. Oo na nga, maganda ka na. Bagay sayo.

4. The Northern Lights, also known as Aurora Borealis, are a natural wonder of the world.

5. Ahhh...wala! Bakit ba, nagdadasal ako noh!

6. Paglingon ko, nakita kong papalapit sakin si Lory.

7. Dapat nating igalang ang kababawan ng bawat tao dahil hindi natin alam ang kanilang pinagdadaanan.

8. Nagreport sa klase ang mga grupo nang limahan.

9. Hanap-buhay niya ang himayin ang mga buto mula sa bulak at gawing sinulid ang bulak.

10. Fra telefoner til computere til tv'er, elektronik har revolutioneret måden, vi kommunikerer og får adgang til information

11. Hindi ko nais makialam, ngunit sa ganang iyo, tama ba ang naging hatol ng hukuman?

12. The Serengeti National Park in Tanzania is a natural wonder renowned for its wildlife and annual migration.

13. Iginitgit ni Ogor ang bitbit na balde at kumalantog ang kanilang mga balde.

14. Hay muchos riesgos asociados con el uso de las redes sociales, como el acoso cibernético.

15. Naniniwala ang ilang tao na ang albularyo ay may kakayahang mag-alis ng masamang espiritu.

16. El maíz es uno de los principales cultivos agrícolas en muchos países de América Latina.

17. Hindi ko alam kung paano maaalis ang aking mga agam-agam sa aking kinabukasan.

18. Me duele el estómago. (My stomach hurts.)

19. At pagkauwiy humiga nang humiga at paulit-ulit na tumingin sa kawalan.

20. Napansin ng Buto na nagsipagtago ang mga hayop sa mga kuweba.

21. Puwede ka ba sa Miyerkoles ng umaga?

22. Ano na nga ho ang pamagat ng palabas ninyo?

23. Upang magpalago ng mais, kailangan mong magsimula sa pamamagitan ng pagpili ng tamang lugar para sa iyong halaman

24. Nakasandig ang ulo sa tagpiang dingding.

25. Cuando no sé qué hacer, simplemente confío en que "que sera, sera."

26. Los fertilizantes orgánicos son utilizados en el cultivo ecológico para enriquecer el suelo.

27. Sa dakong huli, nakita ko ang kasalukuyang sitwasyon ng aking negosyo.

28.

29. He is also relieved of the burden of needless expenses and ultimately becomes a happier and healthier citizen

30. Scissors should be kept sharp to ensure clean and precise cuts.

31. Sa droga, walang nagwawagi kundi ang tao mismo.

32. Biglaan ang pag-ulan kanina kaya ako ay nabasa nang husto.

33. Gusto mong mapansin sa trabaho? Kung gayon, ipakita mo ang iyong husay at sipag.

34. Biglang bumangon ang hari at hinugot ang espada.

35. Maliksi siyang lumapit at binatak ang bata sa liig.

36. Hendes interesse for kunst er fascinerende at se på. (Her interest in art is fascinating to watch.)

37. La tecnología agrícola ha mejorado la eficiencia y la calidad de la producción de los agricultores.

38. If you keep cutting corners, the quality of your work will suffer.

39. Sa takip-silim, nakakapagbigay ng romantikong vibe sa mga tao.

40. Sila ay nagtutulungan upang magtayo ng mga organisasyon at kapatiran upang mapagtibay ang kalagayan ng bayan.

41. Ina, huwag mo po kaming iwan! ang iyak ni Maria.

42. Miss, nakalabas na ba yung pasiyente dito?

43. Mahalaga na hindi tayo mawalan ng pag-asa sa ating mga pangarap.

44. Ayos lang. Basta alam kong safe kang nakauwi.

45. At malaman ng maaga ang wasto sa kamalian.

46. Ahh Mommy, anong oras ba yung flight mo? tanong ni Maico.

47. Microscopes have revolutionized the field of biology, enabling scientists to study the structure and function of living organisms at the cellular and molecular level.

48. Sa tuwing mag-iisa ako, naiisip ko ang aking mga kaulayaw na nasa aking tabi.

49. Pinahiram ko ang aking cellphone kay Alex habang inaayos ang kanyang unit.

50. Hindi ko na kayang itago ito - sana pwede ba kita ligawan?

Recent Searches

dumilimhigh-definitiondahonlintadefinitivometodiskmisusedadmiredreplacedbinataknagandahanlunesinantaykailangangipinanganaknewspapersnakakitanakatunghayhumakbangtransitmarketinghalikannilaoskasuutannakatulogliligawantaglagasideamakawalajuanaccessapobakailangcanteensarabansalungsodnagwalisbilibidfacebookkulangnakalilipasilogcoinbasebrasomatindingpagtutoltsakamaskaraefficientjenamayroongmentalunconventionalmayabangmagtataasdisposalevolucionadoquicklytiniosinknakaka-bwisitsahodpanahonpootdarnahinanapadangsumagotcreatingmananakawtumindigincreasedbusloexpertnag-iimbitatsaaspeechnagkakasyasportskaninoisulatgiyeracredittravelerhimayinpagsusulitbayanikaraokenuevosenchantedmaghapongnamungapagamutanpublicity10thinomskyldeslooblipatalaalahinamakpilipinaslumbaysamakatuwidtindamagnakawimpactednakaraanventalegendsbio-gas-developinge-commerce,dalawlumisanproduktivitetpadabogfreepagtuturomandirigmangbinabapoliticsenforcingtrackemailgabrielmakingpinakabatanglifeipinatawagpagguhitmaghahatidmakidalonapaplastikantanawkinalimutanpasasalamatrabbabalahibobusnakakaanimikinakagalitcasabinentahanhabangconvertidasbinibinipagpilipilaadditionally,walletpositiboctricasuniversitiessineskirtcualquiernagtalagamotionnapakatagalhuwagstartedmakabalikdeletingrose1000machineshumalakhakninyoatinbabadisplacementmoneyatingnag-poutsementeryongisiofferfinishedlikodsiglanagigingnitongtalagapamahalaanpuedeminu-minutostyrernagpasensiyadevelopmentwritetransportcommissionbangladeshstockshumanomerlindainatakepoong