Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Tengo dolor de oídos. (I have ear pain.)

2. Dahil sa lockdown ay bumagsak ang ekonomiya ng Pilipinas.

3. It's frustrating when people beat around the bush because it wastes time and creates confusion.

4. En algunos países, las personas solteras celebran el Día de San Valentín como el Día del Soltero.

5. Ang pagpapakalbo ng kagubatan ay isa sa mga pangunahing dahilan kung bakit nagkakaroon ng pagkawala ng mga punong-kahoy.

6. Lumitaw ang bungang-araw niya sa likod at leeg.

7. Excuse me, may I know your name please?

8. Pinamunuan niya ang mga Pilipino laban sa mga Espanyol at kalaunan sa mga Amerikano.

9. Con paciencia y perseverancia todo se logra.

10. Hi, we haven't been properly introduced. May I know your name?

11. My son drew a picture of a pretty lady with a big smile.

12. Aray! Hinde ko naintindihan yung sinabi mo!

13. Patients may need to follow certain rules and restrictions while hospitalized, such as restricted diets or limitations on visitors.

14. Foreclosed properties may have a lot of competition from other buyers, especially in desirable locations.

15. Ni lumapit sa nasabing puno ay ayaw gawin ng mga taong bayan.

16. Ang hindi magmahal sa sariling wika, ay higit pa ang amoy sa mabahong isda.

17. Microscopes have helped us to better understand the world around us and have opened up new avenues of research and discovery.

18. The team's logo, featuring a basketball with a crown on top, has become an iconic symbol in the world of sports.

19. The city hosts numerous cultural festivals and events, celebrating different traditions and communities throughout the year.

20. Sa kaibuturan ng kanyang puso, alam niya ang tama at mali.

21. Mi aspiración es hacer una diferencia positiva en la vida de las personas a través de mi trabajo. (My aspiration is to make a positive difference in people's lives through my work.)

22. Comer saludable es esencial para mantener una buena salud.

23. Mahalagang mabigyan ng sapat na konsiderasyon ang mga isyu ng sektor ng anak-pawis sa pagpapasya ng mga polisiya ng pamahalaan.

24. Embroidery scissors have pointed tips and small blades for intricate cutting in sewing and embroidery work.

25. I don't know if it's true or not, so I'll take it with a grain of salt until I have more information.

26. Samakatwid, walang makapagsabi kung saan nakatago ang gong.

27. The use of emphasis is influenced by cultural and social norms.

28. Hindi mo na kailangan mag-isa dahil ako ang iyong kaulayaw.

29. Kailangan nating magtiyaga at magsumikap sa ating mga pangarap, datapapwat ay hindi ito agad-agad natutupad.

30. May nakita umano ang mga residente na kakaibang liwanag sa kalangitan.

31. Musk has been married three times and has six children.

32. Ang pagbasa ng mga positibong pananaw at inspirasyonal na mga salita ay nagdudulot sa akin ng isang matiwasay na pananaw sa buhay.

33. Sa bawat pagkakataon na pinagmamalupitan ako, lumalaki ang poot sa aking puso.

34. Pinayuhan sila ng albularyo na magdasal bago mag-umpisa ang gamutan.

35. Nagsasagot ako ng asignatura gamit ang brainly.

36. Ang buhangin sa tabing-dagat ay nagbabaga sa init ng araw kaya’t mahirap itong apakan.

37. I admire my mother for her selflessness and dedication to our family.

38. Many dogs enjoy going on walks and exploring new environments.

39. The patient's immune system was compromised due to their leukemia, and they were advised to take extra precautions to avoid infections.

40. She has been working in the garden all day.

41. Ang pagiging maramot ay salungat sa pagiging bukas-palad.

42. La música puede ser una forma de protesta y expresión de descontento.

43. She enjoys taking photographs.

44. Malaki at maganda ang bahay ng kaibigan ko.

45. Babyens første skrig efter fødslen er en betydningsfuld og livgivende begivenhed.

46. Over-emphasis can be counterproductive and may undermine the intended message.

47. Alangan ako?! Ako na nga unang nagbigay eh! Ikaw naman!

48. She had a weakened immune system and was more susceptible to pneumonia.

49. Sa loob ng ilang taon, yumabong ang industriya ng teknolohiya sa bansa.

50. People who give unsolicited advice are a dime a dozen.

Recent Searches

high-definitionshinesyourself,nogensindedefinitivoiniibigmatuloguntimelyalasmissionambagsitawanihingenenakasuotpisotapevalleyhmmmmmediaparkepogikikogranadaipinasyanghumblepasalamatantinitirhanindiawalongapoysakimsakupindonebumabamulti-billionrichphysicalpinunitsutilfistsdurihamaksumarapperlamarsorailspendingpagenilangjanetig-bebeinte1982simplengregularmentemaputiimpitinfluenceseensofapowersstuffedinspiredbabaviewseasyinterpretingipapainitrestpromotingyearvetosugalagam-agammaingayautomaticstringgeneratedulingincludetwovisualgitanasbehaviorinfinityamazonbilingelectededitorcreatingdraft,increasetipissuesgayunpamanrosanerissanagpakunotnapasukobilermalakibayankasiyahantotoolabasikinasasabikmaibakanya-kanyangagilaumuuwijamesjagiyaenfermedadesdatunananaghilicoursesikinagagalakitinulosnanggagamotquarantinetabingdagatpagmamanehomagpagupitkinalakihandesarrollarnatuwadenreachinglibrengmalezayouthactivitypahahanapscientificnandoondalawninyonamamsyalkuyamiyerkolesfilipinapromoteunconventionalkuligligkasaganaannalamanunitedmapagbigaytumalongalaannaintindihanbagamatmapaibabawpintuancadenauminomareanapakaramingtelevisedwebsitekadalagahangnakapamintanananghihinamadkasalukuyannaninirahanpinagmamalakipalipat-lipatsundhedspleje,pumilimagbabagsiknagsunurannapakamotmakidalonasasakupankapangyarihangnagpatuloypagpapautangvocalpagkuwaobserverermakikipagbabagpinagalitantobaccopagpapatubomagkakaanakmanlalakbaynagkakakaintinatawagkahirapannamulatkinagagalaktelacigarettenaapektuhanevenmagpalagoibinibigaysharmainemovietanggalin