Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Limitations can be financial, such as a lack of resources to pursue education or travel.

2. Ang mga bata ay lumabas ng paaralan nang limahan.

3. Hala, gusto mo tissue? Sorry ah, hindi ko alam.

4. Hindi ko maintindihan kung bakit kailangan pang magpaplastikan kung maaari naman nating sabihin ang totoo.

5. Mahirap maging may agam-agam sa buhay dahil ito ay maaaring magdulot ng pagkabalisa.

6. Les enseignants jouent un rôle important dans la réussite des étudiants.

7. Forgiveness is an act of liberation, allowing us to reclaim our power and live our lives free from the burden of past hurts.

8. Sa pagbabasa ng magandang libro, napapasaya at natutulog ako nang matiwasay sa gabi.

9. La belleza natural de la cascada es sublime, con su agua cristalina y sonidos relajantes.

10. Il fait beau aujourd'hui, n'est-ce pas?

11. The app has also been praised for giving a platform to underrepresented voices and marginalized communities.

12. Tiyakan ang kanyang pagkakapagsalita; ibig niyang sa pagkalito ng bata sa pag-aapuhap ng isasagot ay masukol niyang buung-buo.

13. Gusto ko na po mamanhikan bukas.

14. Natapos ko ang aking trabaho sa opisina sa hatinggabi dahil marami akong backlog.

15. La realidad es que nunca sabemos lo que nos depara el futuro.

16. Ang pag-asa ay nagbibigay ng mga oportunidad sa mga tao upang magpakasaya at mag-enjoy sa buhay.

17. Les enseignants peuvent enseigner différentes matières telles que les sciences, les mathématiques, la littérature, etc.

18. Bumalik siya sa lugar ng aksidente at tulala sa nangyari.

19. Sa tuwing pinagmamalupitan ako, lumalalim ang poot at humahantong sa galit.

20. May problema ba? nagtatakang tanong ni Maico.

21. Jeg tror, jeg er ved at blive forelsket i ham. (I think I'm starting to fall in love with him.)

22. Tumatakbo parin ang metro ng taxi kahit nakatigil ito dahil sa matinding traffic.

23. Inalagaan ito ng pamilya.

24. Nous allons nous marier à l'église.

25. Nagpasama ang matanda sa bahay-bahay.

26. I am enjoying the beautiful weather.

27. Ang dentista ay propesyonal na nag-aalaga sa kalusugan ng ngipin at bibig.

28. The telephone has also had an impact on entertainment

29. Ang mailap na mga bagay ay kadalasang may halaga dahil sa kanilang kakaibang katangian.

30. Sa mga panahong gusto kong mag-reflect, pinapakinggan ko ang mga kanta ng Bukas Palad.

31. Sa kabila ng hirap, ang kanyang loob ay hindi kailanman naging mababa.

32. Sa probinsya, ang mga bukirin ay sumasalamin sa mayabong na kabuhayan ng mga magsasaka.

33. Kapag may tiyaga, may nilaga.

34. Les comportements à risque tels que la consommation

35.

36. Representatives must be knowledgeable about the legislative process, legal frameworks, and policy implications to make informed decisions.

37. Ang paglapastangan sa kalayaan ng pamamahayag at malayang pagpapahayag ay isang pagkitil sa ating demokratikong prinsipyo.

38. Candi Borobudur di Yogyakarta adalah salah satu candi Buddha terbesar di dunia yang sangat terkenal.

39. He does not waste food.

40. Na parang may tumulak.

41. 11pm na. Pinatay ko na ilaw sa hospital room ni Cross.

42. Emphasis is often used to highlight important information or ideas.

43. Oscilloscopes can be connected to a computer or network for data logging, remote control, and analysis.

44. Umiiyak siyang gumuglong sa basa at madulas na semento.

45. Nakaakma ang mga bisig.

46. Binasa niya ang balikat, ang mga bisig.

47. Maganda ang mga alaala ko dito sa Pilipinas.

48. Ako'y napatingin sa dalagang nababalot ng hiwaga

49. Ailments can be diagnosed through medical tests and evaluations, such as blood tests or imaging scans.

50. Starting a business during an economic downturn is often seen as risky.

Recent Searches

high-definitionrosellemayamansumasakittodolayout,misusedsumamabriefdalandandollymaskfeedback,terminoshowswestgawaiwanandeathintroducetransitduripersonalasindyanschoolsspecialhamakdisappointaccuracybilanginbookstipdivisiontutorialserrors,learningshifttopicwhetherpaceinvolvepilingpuntaelectronicsipaglossprimerboyfriendkadaratingtemperaturaconcernsminamasdanbabalikistasyonambisyosangbilugangeitherdespuestalagangpagiginginteligentesflightsinapakpinangalanangperatomprogresso-orderpagsalakayvictoriadospotentialmaayosibalikpalagaymagbalikawardwarirecentliligawanlayuninpulubisalbahengkatawansalbahekuripotkalikasankargahanpumulotmanghikayatwaitermusiciancountrypunong-kahoyhonestoadvertisingartificialpinatirasana-alltermnakilalapagtangohinaboltanyagcandidatesasagotagilasundaelipatstudieddiligintilajunjunneed,tanawinalignshinihilingadmiredkatagangtulungannagawangtiyanuntimelybutdrawinguugud-ugodmalungkotdahan-dahanayudanakikisalosapatmartialculturasnagwo-workharisunud-sunodmorenaniwalatonightcompanynagsagawaoperativoshuertomayakahitkabuhayanpalabuy-laboyonlinethreeagam-agamkanyaviewsabundantedahanpanaymaskinertagtuyotdumilathidingdeclaregoodnami-missmagpagalingputingsumagotmapakaliiiwasanmedidapakinabanganpagdudugohuludoingkunwamaliitkinasuklamanpumitasaminnatanongmaratingmakikipag-duetowalamateryalesbook:pinagkasundonakalockkakahuyanlalakilabinsiyammakawalaharapancniconatulogaumentarhapasinnationalenergymalapalasyonariningika-12