Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Limitations can be perceived as weaknesses, but they can also be strengths and opportunities for growth.

2. Nice meeting you po. automatic na sabi ko.

3. Ang panaghoy ng mga manggagawa ay umalingawngaw sa buong pabrika.

4. Napakabagal ng proseso ng pagbabayad ng buwis, animoy lakad pagong.

5. Nahuli na kahapon ang nagnakaw ng kalabaw ni Mang Arturo.

6. Representatives are accountable to their constituents, who have the power to elect or remove them from office through elections.

7. Ang kabanata ay nagbigay ng mahahalagang detalye tungkol sa nakaraan ng pangunahing tauhan.

8. Foreclosed properties may be sold in as-is condition, which means the buyer may have to make repairs or renovations.

9. Einstein was born in Ulm, Germany in 1879 and died in Princeton, New Jersey in 1955.

10. Ang laki ng kalabaw ni Mang Jose.

11. Leonardo da Vinci nació en Italia en el año 1452.

12. The "News Feed" on Facebook displays a personalized stream of updates from friends, pages, and groups that a user follows.

13. He cooks dinner for his family.

14. Ang mga pagtitipon sa mga pistaan at mga malalaking lunsod ay nagpapakita ng kasiglahan at saya sa pagdiriwang ng Chinese New Year.

15. Ang pagtawanan at mag-enjoy kasama ang mga kaibigan ay isang nakagagamot na aktibidad.

16. Beauty ito na oh. nakangiting sabi niya.

17. Tila hindi siya kumbinsido sa iyong paliwanag.

18. Maarte siya sa kanyang kagamitan kaya hindi siya nagpapahiram ng kanyang mga bagay.

19. Gising ka pa?! parang nabigla nyang sabi.

20. Samantalang ang ina naman, si Magda, siyang nag-aasikaso sa kanilang bahay at dalawang anak na sna Maria at Jose

21. Bawal mag-smoke sa loob ng opisina dahil sa panganib na dulot ng usok sa kalusugan ng ibang tao.

22. La falta de vivienda adecuada y segura es un problema común para las personas pobres.

23. I have never been to Asia.

24. Ang mga kawal nagsisilbi sa bayan upang protektahan ang mamamayan.

25. Dahil sa kahirapan natuto siyang magnakaw at mandukot

26. Dumating siya mula sa Bikol kahapon ng umaga.

27. Malapit lamang pala ang pinaghatidan nito ng tubig.

28. Hindi ko nakita ang kubyertos sa lamesa, kaya nagtanong ako sa waiter.

29. Kung hindi siya maramot, baka mas marami ang natulungan niya.

30. Si Maria ay na-suway sa utos ng guro na tapusin ang kanyang takdang gawain.

31. Amazon's Kindle e-reader is a popular device for reading e-books.

32. Ang ibig Sabihin ng morena ay hindi maitim hindi maputi

33. A picture is worth 1000 words

34. She was named as one of Time magazine's most influential people in the world in 2016 and 2019.

35. Bakit ho, saan ninyo ko dadalhin?

36. Los héroes son fuentes de esperanza y fortaleza en tiempos difíciles.

37. Her music career took off with her debut album Yours Truly in 2013, featuring the hit single "The Way."

38. Kucing di Indonesia sering dijadikan sebagai hewan peliharaan yang cocok untuk apartemen atau rumah kecil.

39. Ang maniwala sa sabi-sabi, walang bait sa sarili.

40. Maraming mga artist ang nakakakuha ng inspirasyon sa pamamagitan ng pagguhit.

41. Pumunta kami sa Cebu noong Sabado.

42. Tumayo ako tapos tumayo rin si Carlo.

43. Inihayag ng mga empleyado ang kanilang mga mungkahi upang mapabuti ang mga proseso sa opisina.

44. She is not studying right now.

45. Ang aming kasal ay nagpapakita ng pagkakaisa at pagmamahal sa pagitan naming dalawa bilang magkabilang kabiyak.

46. Nakita ko ang aking guro sa mall kanina kasama ang kanyang pamilya.

47. The Lion King tells the tale of a young lion named Simba who must reclaim his kingdom from his evil uncle.

48. Hospitalization can have a significant impact on a patient's overall health and well-being, and may require ongoing medical care and support.

49. Mathematics can be used to analyze data and make informed decisions.

50. Left-handed scissors are specially designed for left-handed individuals to ensure comfortable and efficient cutting.

Recent Searches

high-definitione-booksdumaramiuniqueorugapaalisbituinrelevantpa-dayagonalalexanderpalasyobalahibobayabaskagandahantopickasakitkaaya-ayangpumasoklagnatnagkwentopagkaawasinipangmagpa-picturebitawanmakalabaspaparusahanpalaisipankasalanannararapatma-buhaykayclubstatepasyamahuhulikapamilyapsssmasayanglihimdalawnatatanawmassesmagpalibrekananwikamagdoorbellposporongunitareasmulatravelernakaraanreachhinaboltalagabilihinpinagpagpiliformasprimerostig-bebentekartonpagguhitmalambingbasahinincreasedcoaching:klimapositibomakabalikmerlindaindiaobra-maestranerissatransitnauliniganlungsodbotebilugangsumangroomsong-writinganumanh-hoybowrobinhoodatine-commerce,tasaplanlargekadaratingsmokinginisrobertnapakahusayoraspaksaanibersaryomagbagong-anyoexcusemonsignorleomindandyiigibfatalrequiremulighederbasahanrosajuanhinigitnakapapasongpatalikodhinilatobaccoyantitadatasumasambadesarrollaronsantokumaentekaspeechesnagtataepangitbevarepagsisisimatandadali-daliourmanggagalinggulohinabinakabulagtangverytagalogmatitigasniyogimpactedlasmahahanaynananalongpagkahapokakayanangkinalakihanpersistent,ipinikitmitigatelulusogmagta-taxilaryngitistinuroninanaisantokhayophanapbuhaylayascommissionkatagalannakahainpulatwinklesakristanmaniladarkpagamutanryanlalabastrainingagadmayuminggenerationernatutulogumokayhealthiernakalilipasnakukuhanasiyahankamalianfiakawili-wilimatatawagngacreateflyvemaskinermangangahoyliveshoynamataynakangisibotantekasamathennaghinalasubalitmagtatanimnapakabilis