Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Ang mga puno at halaman ay nag po-produce ng oxygen.

2. She has been knitting a sweater for her son.

3.

4. Kadarating mo pa lamang, Ogor, nais niyang itutol.

5. Jennifer Aniston gained fame for her role as Rachel Green on the television show "Friends."

6. Matayog ang pangarap ni Juan.

7. Kumain ako ng macadamia nuts.

8. Isa sa paborito kong kanta ng Bukas Palad ay "I Will Sing Forever".

9. L'auto-discipline est également importante pour maintenir la motivation, car elle permet de s'engager dans des actions nécessaires même lorsque cela peut être difficile.

10. Tesla's Powerwall is a home battery system that allows homeowners to store energy for use during peak hours or power outages.

11. Na-suway ang driver ng tricycle nang lumabag ito sa batas trapiko.

12. Nakikita mo ba si Athena ngayon?

13. Kaninong payong ang dilaw na payong?

14. Nationalism can be both inclusive and exclusive, depending on the particular vision of the nation.

15. Oo nga noh? Pero di bale, advance gift ng ninong. aniya.

16. Drømme kan være en kilde til kreativitet og innovation.

17. Nang natapos ang araw ng pagsusulit, gumawa ng paraan ang binata para makabawi sa dalaga.

18. Oy oy! Tama na yan baka maaksidente tayo!

19. The restaurant messed up his order, and then the waiter spilled a drink on him. That added insult to injury.

20. La película que produjo el estudio fue un gran éxito internacional.

21. Napakalaki talaga ng isla sa boracay.

22. I forgot my phone at home and then it started raining. That just added insult to injury.

23. The patient experienced hair loss as a side effect of chemotherapy for leukemia.

24. Las hojas de papel se pueden reciclar para hacer papel nuevo.

25. Nangahas ang manunulat na talakayin ang kontrobersyal na isyu sa kanyang aklat.

26. Naramdaman ko ang kalungkutan na unti-unti nang napawi nang matanggap ko ang magandang balita.

27. Initial coin offerings (ICOs) are a means of raising capital through cryptocurrency crowdfunding.

28. Mas malaki ang huli, mas marami rin ang panindang maipapautang sa iyo ng ngingisi-ngising negosyante.

29. Ang lakas mo uminom wala ka naman ambag.

30. Sa isang tindahan sa may Baclaran.

31. Sa pagkakatumba ni Aya, nanlilisik pa ang mga matang tumingin sa ama.

32. During his four seasons with the Heat, LeBron won two NBA championships in 2012 and 2013.

33. Me da miedo pensar en lo desconocido, pero al final, "que sera, sera."

34. The athlete completed a series of intense workouts to prepare for the competition.

35. La voiture rouge est à vendre.

36. Hindi dapat natin pahintulutan ang paglapastangan sa kapakanan ng mga batang nasa mapanganib na kalagayan.

37. Ganoon ng ganoon ang nangyayari.

38. Ang mga punong-kahoy ay kabilang sa mga pangunahing likas na yaman ng ating bansa.

39. Ako. Basta babayaran kita tapos!

40. Nagbigay ng malaking tulong sa akin ang aking guro sa paghahanda sa aking thesis.

41. Sama-sama. - You're welcome.

42. She was named as one of Time magazine's most influential people in the world in 2016 and 2019.

43. Pumunta daw po kayo sa guidance office sabi ng aking teacher.

44. Ang paglabas ng mga hayop mula sa koral ay binulabog ang katahimikan ng bukid.

45. Shows like I Love Lucy and The Honeymooners helped to establish television as a medium for entertainment

46. The bookshelf was filled with hefty tomes on a wide range of subjects.

47. Fødslen markerer en begyndelse på et nyt kapitel i livet som forældre og en påmindelse om, at livet er en konstant cyklus af transformation og fornyelse.

48. La creatividad es fundamental para el desarrollo de ideas innovadoras.

49. Mas mahalaga ang kabutihan ng kalooban kaysa sa kababawang kasiyahan.

50. Sa kasalukuyan, yumabong ang interes ng mga tao sa pagsasaka ng mga organic na gulay.

Recent Searches

high-definitionbecamelilymaidpinunitparusaelitepagtatanghallayaspaglapastangantapatamomorenainomhiningikrussinimulananimpriestmaulitpracticadobroughthamakmanuscriptulaminantokjoshlingidiniwansupremeneropasokcoachingsorrywellpaypasyakalanbokpagtinginworkshopconductdagoknakapagusapngunitdeclare1982qualitypublishingumilingnasundohardpalayansumapitpaligidkakilaladuloitemsbasainternalcirclesummitthinglibagjohnpingganhinahaplosikawmarianoffentligdahan-dahancomputerstinighadlangberetitenaniyatypesikinakagalitsasakaynownakapaglaronaghihirapisa-isapilipinascualquierpaskodiliginusaelectionsjokemukaaudio-visuallyguiltyproblemamaispagpapasankapangyarihangkwenta-kwentanamulaklakt-shirtpagpapakalatdi-kawasarevolutionizedkaano-anomedisinakusineronabubuhaysiniyasatdapit-haponpinabayaannalalabipamamasyalnailigtasgasolinamaipapautangninanaistemparaturamananalopumitasinvestnagtakanangyaricorporationnakatuonkontinentengsay,makapalilalagaydropshipping,kongresonapatulalajosiepaulit-ulithonestopakakasalankaliwagumuhitnakabluenahahalinhanprincipalespasahekamalianpalantandaanmangingisdangsusunodtagpiangnewspropesorpakiramdamnagniningningkenjisakop3hrsadvertisinglugawgustongakmangpagbatitinikmankabarkadainfusionesaregladolayuaninventionmukhatanawpulongkakayananumigibapologeticalakamericaninintaypersonaguaalmacenarpagdamitenganyanpeppypusapangiltsuperkirotmangingibigdesarrollarkasalgraphiccountriescassandracombinedexhausteddisyembrekinainkasaysayanadditionally,widelytrajesukat