Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Walang anuman saad ng mayor.

2. In recent years, television technology has continued to evolve and improve

3. Lagi nating isipin na ang mga pagsubok sa buhay ay hindi dapat maging hadlang upang maipagpatuloy ang ating buhay.

4. Emphasis can help to ensure that a message is received and understood by the intended audience.

5. Dapat bigyang pansin ang kawalan ng seguridad sa trabaho ng mga manggagawa at magsasaka bilang bahagi ng sektor ng anak-pawis.

6. Nanatili siya sa isang mataas na puno at nagmasid-masid ulit muna ito at inantay kung sino ang mukhang nananalo.

7. Arbejdsgivere kan bruge fleksible arbejdsmetoder for at hjælpe medarbejdere med at balancere deres arbejds- og privatliv.

8. Nakangiti siya at ang babae ay ngumiti rin.

9. Bien que le jeu puisse être amusant et excitant, il est également important de se rappeler qu'il peut avoir des conséquences négatives s'il n'est pas géré de manière responsable.

10. Napakalungkot ng balitang iyan.

11. E ano kung maitim? isasagot niya.

12. Nakalimutan kong magdala ng lapis sa silid-aralan kaya nagpahiram ako sa aking kaibigan.

13.

14. I found a great recipe on a cooking website that I can't wait to try.

15. Dancing all night at the club left me feeling euphoric and full of energy.

16. Lasinggero ang tatay ni Gabriel.

17. Hindi dapat natin pahintulutan ang paglapastangan sa kapakanan ng mga batang nasa mapanganib na kalagayan.

18. He does not argue with his colleagues.

19. En invierno, los deportes en el hielo como el hockey sobre hielo y la patinaje sobre hielo son muy populares.

20. Agad na kumalat ang balita na may dala si Ana na pagkain, kaya sumugod sila sa bahay ni Aling Rosa.

21. Claro que entiendo tu punto de vista.

22. Oo naman 'My! Walang hihigit pa sa Beauty ko noh.

23. At leve i overensstemmelse med vores personlige overbevisninger og værdier kan styrke vores samvittighed.

24. Si Maestro Ryan ay napakahusay magturo.

25. Kasama ang katipunan, Matapang na pinunit nina Andres Bonifacio ang cedula bilang protesta sa mga espanyol.

26. Kahit malayo ka, hindi nawawala ang pagkagusto ko sa iyo. Crush kita pa rin.

27. Ngumiti ako saka humalik sa mga labi niya.

28. The Grand Canyon is a breathtaking wonder of nature in the United States.

29. Vi skal fejre vores helte og takke dem for deres indsats.

30. Danske virksomheder, der eksporterer varer til Kina, har haft stor succes på det kinesiske marked.

31. Lahat ng magagaling na maghahabi ay napakahanga sa kakayanan ni Amba.

32. Kumaliwa ka sa susunod na kanto.

33. He might be dressed in casual clothes, but you can't judge a book by its cover - he's a successful business owner.

34. Mathematics is a language used to describe and solve complex problems.

35. Si Maria ay malakas ang boses, bagkus ang kanyang kapatid ay tahimik.

36. The birds are chirping outside.

37. La paciencia es una virtud que nos ayuda a ser mejores personas.

38. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

39. Kapag lulong ka sa droga, mawawala ang kinabukasan mo.

40. Nagtatanim siya ng mga gulay at nanghuhuli ng mga hayop sa gubat upang kanilang pagkain

41. A couple of weeks ago, I went on a trip to Europe.

42. Tapos nag lakad na siya papunta sa may kotse.

43. Helte kan have en positiv indflydelse på hele samfundet.

44. Nareklamo ko na ho ito pero wala hong sagot.

45. Pinagsulat si Jayson ng pangungusap sa pisara.

46. Hendes personlighed er så fascinerende, at jeg ikke kan lade være med at tale med hende. (Her personality is so fascinating that I can't help but talk to her.)

47. Overall, money plays a central role in modern society and can have significant impacts on people's lives and the economy as a whole.

48. Kahit nasa gitna ng kainan, siya ay tulala at parang may iniisip.

49. Hindi maganda na palaging may agam-agam sa buhay, dahil ito ay maaaring magdulot ng stress at anxiety.

50. Kasi ho, maraming dapat kumpunihin sa bahay.

Recent Searches

sakimsitawiniibighotelforståhigh-definitionlasaphilosophicalgatassimbahanalexandernunolegislationinomnoblevalleybakautilizaaabotbumabaharefersbruceabstaininguncheckedrosesinabidyantherapynaritomayabongpagsidlananimoylasingerofaketingsparkminutowestritoubodpanguloinumineveningneroadditionallyenforcingleditimhariworkingnegativeendarmedroquecircleparatingnaggingedit:attackdumaramiberkeleykasingbinilingnagpaiyakmagbayadsyanakaka-inpinigilannakangisimabagalmakuhangadvancementgumigising1960sliligawanulomaliitbinatakmanuscriptconsistcollectionstablestatingmasaksihannakangisingtilaideapaligsahansinatravelerkasoynapapasayataga-tungawnagtaposdiseasesmaligomisusedsikre,tuladkinakabahanprinsesatambayanmedya-agwapalaytshirtmaibiganindiakinalimutanbevarenagpakitasiguromaatimnakisakaybutterflytrafficdonmedyocallerkinagagalakinantokkalikasanbecomingnagkakakainpangungutyanangagsipagkantahannamumulaklakmakapaibabawnapakatagalikinamataymonsignorpinabayaaninilalabasliv,pinagalitansalamangkerohila-agawankagalakanhitsurapagpapautangnagpalalimbisitatanggalininvestnaapektuhanaktibistanauliniganfilipinapangangatawansulyapnagtakapinuntahanmaintindihanyumuyukoengkantadangkinalilibingantumahannalamanmagkasamanaiisiptinawagpahirammanatilinareklamoumiibigkontinentengbutikinakatuonpaghangamagpasalamatiniindananunurinanalonakalockkesomasaholgovernorsnagwalishahahakisapmataperyahankuripottumaposmaghaponmaestragusaliginoongrightskundimanobservation,marangalsocialespormaibigaymabigyandadalococktailbaguioenergymartiantatlong