Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Ang aking teacher ay hindi muna nagturo ngayong araw.

2. I got a new watch as a birthday present from my parents.

3. Umuwi na ako kasi pagod na ako.

4. She is cooking dinner for us.

5. El cultivo de tomates requiere un suelo bien drenado y rico en nutrientes.

6. Lumiwanag ang lansangan dahil sa bagong ilaw trapiko.

7. Martabak adalah makanan ringan yang terbuat dari adonan tepung dan isian kacang, daging, atau keju.

8. Lebih baik mencegah daripada mengobati.

9. Ipaliwanag ang mga sumusunod na salita.

10. At følge sin samvittighed kan nogle gange kræve mod og styrke.

11. Ang mga bayani ay nagbibigay inspirasyon sa mga kabataan upang maging mabuting mamamayan.

12. Ang pagkain ng masusustansyang pagkain at pag-aalaga sa aking katawan ay isang nakagagamot na paraan upang mapanatili ang aking kalusugan.

13. Nagitla ako nang biglang tumunog ang emergency alarm sa opisina.

14. Il est important de prendre en compte les risques potentiels et de faire des recherches approfondies avant de décider de participer à des activités de jeu.

15. Maramot siyang magpahiram ng kanyang mga libro dahil takot siyang masira ang mga ito.

16. Kebahagiaan adalah perjalanan pribadi yang unik bagi setiap individu, dan penting untuk menghormati dan mencari kebahagiaan yang paling sesuai dengan diri sendiri.

17. Paano ako pupunta sa airport?

18. He has been repairing the car for hours.

19. Taga-Ochando, New Washington ako.

20. Limitations can be perceived as weaknesses, but they can also be strengths and opportunities for growth.

21. Ang mga bayani ay nagpapakita ng disiplina at determinasyon sa paglutas ng mga problema ng bayan.

22. Ang pagkikita at pag-uusap sa isang propesyonal na tagapayo o therapist ay nakagagamot sa aking emosyonal na kalagayan.

23. Some of her most famous songs include "No Tears Left to Cry," "Thank U, Next," "7 Rings," and "Positions."

24. Kailan ba ang flight mo?

25. Tesla's Powerwall is a home battery system that allows homeowners to store energy for use during peak hours or power outages.

26. Gaano katagal ho kung sasakay ako ng dyipni?

27. Emphasis is often used in advertising and marketing to draw attention to products or services.

28. She enjoys drinking coffee in the morning.

29. Ipinakita ng albularyo ang kanyang halamang gamot na ginagamit niya sa pagpapagaling.

30. Dumating ang mga kamag-anak ni Fe.

31. Nagsilabasan ang mga taong bayan.

32. Es importante ser cuidadoso con la información personal que se comparte en las redes sociales.

33. Anong lugar ang pinangyarihan ng insidente?

34. Ang trahedyang naganap sa kanilang komunidad ay nagdulot ng pangmatagalang lungkot sa kanilang mga puso.

35. El agua es un símbolo de pureza, vida y renovación.

36. Naniniwala ang mga Katoliko na ang mga dasal para sa mga kaluluwa sa purgatoryo ay makakatulong sa kanilang kaligtasan.

37. Ha?! Ano ba namang tanong yan! Wala noh!

38. Los Angeles is home to several professional sports teams, including the Lakers (NBA) and the Dodgers (MLB).

39. La prévention est une approche importante pour maintenir une bonne santé et éviter les maladies.

40. Bukas ay kukuha na ako ng lisensya sa pagmamaneho.

41. Different investment vehicles offer different levels of liquidity, which refers to how easily an investment can be bought or sold.

42. Coffee has been shown to have several potential health benefits, including reducing the risk of type 2 diabetes and Parkinson's disease.

43. Dahil sa kagustuhang malaman ng mga kapatid ni Psyche ang hitsura ng asawa, tinanggal nila ang maskara nito at tumambad ang magandang mukha ni Cupid

44. La alimentación saludable debe incluir una variedad de proteínas, carbohidratos y grasas saludables.

45. This is not the time to fall apart, pull yourself together and think clearly.

46. Ang lakas mo uminom wala ka naman ambag.

47. Masarap maglakad sa dapit-hapon dahil mas malamig na ang hangin.

48. Oh di nga? Nasaang ospital daw?

49. Nagbenta ng karne si Mang Jose kay Katie.

50. Algunas serpientes son capaces de desplazarse en el agua, mientras que otras son terrestres o arbóreas.

Recent Searches

insteadbosstungkodhigh-definitionsundaeplatformmakabalikuncheckedzooamazondiyosbulongpagsasalitaeveningbrindarkantopinaghawlakatagalannakagawiankontrapaghihingalotaglagasbalevetonasasabihanconclusion,burgerkumunotkatagangmorede-lataritaitinindiglimitedvidenskabisinuothanapbuhayteacherasiakisstreatsnaiiritangtennisipinauutangnilagangkagandahanadganghinimas-himasnasagutanpanalangininterests,partnerikinagagalakgaanoteksttinataluntonpusapelikulatinahaknangahasmabaitdilawisasabadscientificpapayatoribiodibamedisinashouldfidelpanitikan,lilimnagbiyayaautomaticpangyayariwarimagkakapatidmagsusunuranmaliwanagjosiestylesfertilizermagpagalingsandwichstopsoundkabuhayanunattendedisinalangjoseprosesodisappointjackymanilbihanmaaringtillincreasedirogbaldechangemahinogpositibopangitorugaevolucionadotargetsasapakinpagsagoteithernatingalaalapaapmahihirapnagdadasaltakotisaacinterviewingprimerlabing-siyampinalakingsedentarystyreralexanderregularmentesumayawrelysakalingabihumalakhakpagkatnewspaperskondisyonpackagingmalulungkotmagagawaiyongeclipxecrosspaanokamisetanghighbataymakeskriskabuwayamasayahinpalakolahaspublicationrequierenmethodsaddressdependlangitmaliksilahatfacultylumipadpangalanalbularyotangankasinggandaavailablemakitamosthinanakitnanghingipilipinonakasabitpamahalaankalyepaghuhugastumatawadkumikilostugondividedmahahabacoughingjocelynsasamahanpropensoyeytulisang-dagatpag-uwipagkapasoknagpapasasahumihingimagturoredesmatagpuanjingjingkanginamaskidosfatalikinalulungkotayudasequecallingconnection