Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. "Mahalaga ang edukasyon," ani ng aking ama noong bata pa ako.

2. Sa loob ng isang saglit, hindi niya maulit na salatin ang biyak na pisngi.

3. Twinkle, twinkle, all the night.

4. No hay mal que por bien no venga. - Every cloud has a silver lining.

5. Maaga kaming nakarating sa aming pupuntahan.

6. Nais niyang mag-iwan ng sulat para sa kanyang mahal.

7. Les travailleurs peuvent changer de carrière à tout moment de leur vie.

8. Sa mga sitwasyon ng buhay, ang mailap na oportunidad ay kailangan mabilis na kinukuha.

9. Ofte bliver helte hyldet efter deres død.

10. Sabay sabay na nagtanghalian ang mga estudyante sa canteen.

11. The sun does not rise in the west.

12. "Bawal magtapon ng basura rito," ani ng bantay sa parke.

13. Ang pagkakaroon ng mapagkakatiwalaang kaibigan ay siyang ikinagagalak ni Carla.

14. Tesla has a strong and passionate community of supporters and customers, known as "Tesla enthusiasts" or "Teslaites."

15. Las hojas de los cactus son muy resistentes y difíciles de cortar.

16. Ang paglalabas ng mga pahayag na alam na hindi totoo ay nagpapakita ng pagiging bulag sa katotohanan.

17. Lazada has a reputation for offering competitive prices and discounts.

18. Kung maramot ka sa pagbigay ng tulong, huwag magtaka kung walang tutulong sa'yo.

19. Ang pang-aabuso sa droga ay nagdudulot ng malalang problema sa kalusugan ng mga tao.

20. Some people find fulfillment in volunteer or unpaid work outside of their regular jobs.

21. "Ang batang matalino, may alam sa lahat ng bagay" ay isang bukambibig na nagpapahayag ng husay at talino ng isang batang may malawak na kaalaman.

22. Sige. Heto na ang jeepney ko.

23. Magsasalita pa sana siya nang biglang may dumating.

24. Dapat bigyan ng karampatang atensyon ang mga isyu ng sektor ng anak-pawis.

25. Eine klare Gewissensentscheidung kann uns helfen, uns selbst treu zu bleiben.

26. Ang bungang-araw ay madalas tumutubo tuwing tag-init.

27. Nationalism can also lead to authoritarianism and repression of dissent.

28. Ha? Anong konek ng gas sa taong nagugutom?

29. Nationalism can be a source of conflict between different groups within a nation-state.

30. Inaamin ko rin na kulang ang aking nalalaman.

31. Pakibigay na lang sa punong-guro ang liham ng mga magulang mo.

32. The football field is divided into two halves, with each team playing offense and defense alternately.

33. Ano kaya ang pakiramdam ng nakasakay sa eroplano.

34. Hindi dapat sumuko agad kapag mailap ang posibilidad ng tagumpay.

35. Sa bawat tula ng makata, maririnig ang malalim na hinagpis ng kanyang puso.

36. Electric cars may have a higher upfront cost than gasoline-powered cars, but lower operating and maintenance costs can make up for it over time.

37. Durante el siglo XX, se desarrollaron diferentes corrientes musicales en España, como el Nuevo Cine Español y el flamenco

38. Lazada's parent company, Alibaba, has invested heavily in the platform and has helped to drive its growth.

39. Ngunit kailangang lumakad na siya.

40. Les enfants ont des besoins de santé particuliers qui doivent être pris en compte.

41. Parang itinulos sa pagkakatayo ang mag-asawa at di malaman ang gagawin.

42. Sino ang nakasuot ng asul na polo?

43. En boca cerrada no entran moscas.

44. The La Brea Tar Pits are a unique natural attraction, preserving fossils and prehistoric remains.

45. During the holidays, the family focused on charitable acts, like giving gifts to orphanages.

46. Maraming ideya na ibinibigay ang brainly.

47. He has been gardening for hours.

48. Sa katagalan, natanggap na niya ang panunuksong ito.

49. Ang malakas na tunog ng sirena ay binulabog ang katahimikan ng lungsod.

50. Sige na. Kami na lang bahala dito. sabi sa akin ni Grace

Recent Searches

high-definitionmagtipidnanangisjenaenergidissesumisilipbilanginlarolalabasahinmejomalambingalexanderblusangtiketsipakalakingnasabingmassessanggivesalarinbuwalideasbugtongsorehumanokondisyonpagpapakaintripmapakalifatstevecoaching:kabilangdependingwithouttomfullfatalpabalingatumiinitlever,anothersedentarypodcasts,pwedenghanapbuhayprotestapagtawaanistorypanatilihinrobertiniindamagbibiladmagtrabahoflashneedsmagbubukidfilipinapaghaharutanpinagkakaabalahanpakakasalanrespektivecommercialde-latapagdogsosakaimportanteturonkatagalannalugodwhatsappmininimizewariyeahbilugangitinagotataasdaraanannyastillbuhawipasensiyailanitinaliburdenaseangisingsalaminfansinteriorviewburolsunud-sunodinaallowedandremakisuyotabingreaksiyongumandafaultkategori,sagasaanmasayahinpropensorepresentativebalikvideoskahilinganmalulungkotharnagbibigaycorporationspecializedfreelancerpalibhasaipinanganaklingidearningbustogetherarturokusinadumilatnapadpadwakaseksport,konsyertosakristannapakamotpinagkiskisminu-minutotatawagmahahanaytienenpagtiisannakakunot-noongnakakapamasyalmasayang-masayanglarawangayunpamantungkolkatagadagatbastagurokahirapangawingpagongmerlindanakatayokaaya-ayangbangladeshnagbanggaanmagpa-checkupnakikilalangmakukulaykwartohandaanaplicacionesinvestmagsi-skiingmaipagmamalakingnegosyosinusuklalyannangangakobyggetmahinanapapansinmarurumihalu-halokulturpalasyotuktokipinauutangestasyonharapanitinatapatkalaroligayatalagangitinaobgalaanpapalapittumindignakakamaglabanapadaanmartiantagalmahigitsigurotmicabilanggoproseso