Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Pedro! Ano ang hinihintay mo?

2. Every year on April Fool's, my dad pretends to have forgotten my mom's birthday - it's a running joke in our family.

3. Kung sino ang maagap, siya ang magandang kinabukasan.

4. Las heridas en niños o personas mayores pueden requerir de cuidados especiales debido a su piel más delicada.

5. Ang masasakit na salitang binitiwan nya ay lubos na nakasakit sa kanyang ina.

6. En el siglo XVII, el Barroco español produjo figuras importantes como Francisco Guerrero y Tomás Luis de Victoria

7. Working in a supportive and positive environment can improve job satisfaction.

8. Pneumonia can be life-threatening if not treated promptly.

9. Narinig ni Ana ang boses ni Noel.

10. Ang ganda na nang bagong Manila zoo.

11. Ang magnanakaw na kumaripas ng takbo ay nahuli rin sa dulo ng kalsada.

12. Saan nagtatrabaho si Roland?

13. The restaurant messed up his order, and then the waiter spilled a drink on him. That added insult to injury.

14. L'intelligence artificielle peut aider à prédire les comportements des consommateurs et à améliorer les stratégies de marketing.

15. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

16. O sige na, sige na! Tumahan ka na lang!

17. Proper maintenance, such as regularly oiling the pivot point and cleaning off debris, can prolong the lifespan of scissors.

18. Fra biler til fly til tog, teknologi har gjort det muligt for os at bevæge os hurtigere og mere effektivt end nogensinde før

19. All these years, I have been grateful for the journey and excited for what the future holds.

20. Hiram muna ako ng libro na iyon bago ko desisyunang bilhin ito.

21. Umayos naman ako ng higa at yumakap patalikod sa kanya.

22. She is not cooking dinner tonight.

23. Napakaganda ng mga pasyalan sa bansang Singapore.

24. La tormenta produjo daños significativos en la infraestructura de la ciudad.

25. Limitations can be challenging, but they can also inspire creativity and innovation.

26. The widespread use of the telephone has had a profound impact on society

27. Hindi mo alam ang kanyang tunay na nais dahil hindi mo alam ang kanyang kaibuturan.

28. Leonardo da Vinci diseñó varios inventos como el helicóptero y la bicicleta.

29. Hay muchas formas de arte, como la pintura, la escultura, la danza y la música.

30. Masaya ang pakanta-kantang si Maria.

31. Tumalikod siya bigla saka pumasok sa kwarto niya.

32. Marami siyang ginawang pagkakamali sa proyekto, samakatuwid, hindi ito natapos sa takdang oras.

33. Advanced oscilloscopes offer mathematical functions, waveform analysis, and FFT (Fast Fourier Transform) capabilities.

34. Ang biglang pag-alsa ng mga manggagawa ay binulabog ang industriya ng paggawa.

35. Las pinturas abstractas pueden ser interpretadas de diferentes maneras por el espectador.

36. Papunta siya sa Davao bukas ng tanghali.

37. Lumalaon ay dumarami ang tao sa paligid at ang pulis na umuusig ay tila siyang-siya sa kanyang pagtatanong at pagsusulat sa kuwaderno.

38. Nagpakilala ang binata bilang isang prinsipe ng isang malayo at kaibang kaharian.

39. Ibinigay ng aking guro ang kanyang oras at dedikasyon upang masiguro ang aming matagumpay na pagkatuto.

40.

41. He has been to Paris three times.

42. Ibinigay ko ang aking payo at opinyon upang makatulong sa pagresolba ng problema.

43. Fødslen kan også være en tid til at forbinde med ens partner og skabe en dybere forståelse og respekt for hinanden.

44. Hiram muna ako ng iyong kamera para kuhanan ang mga litrato sa okasyon.

45. Marunong nang maglinis at magtago ang mga taong marurumi.

46. Mayroon akong mga alinlangan sa kanilang plano kaya ako ay tumututol dito.

47. Sa kanyang kaarawan, pinuno niya ang kanyang mesa ng mga masasarap na pagkain kaya't ito ay hitik sa mga putaheng lutong-buong.

48. Women have made significant contributions throughout history in various fields, including science, politics, and the arts.

49. Doa juga bisa dianggap sebagai bentuk ungkapan syukur atas nikmat dan karunia yang diberikan Tuhan.

50. Hindi lang nila naririnig kundi nakikita pa ang katuwaan ng lahat.

Recent Searches

napatinginhigh-definitionmindmakapilingbotebestaiddrewlastingnapakabutihimselflikelyheftyevolvetoolsamantalanguminomnapakatagalliv,musiciangandahanmagpapagupitmaipagmamalakingpambahayairportlumamanghinugottinungopagtatanimnahintakutanwesternkulunganpatakbongdakilangmaaksidentenakapanghihinaturonnagisingnyesagotpagbisitatotoongwifisagapparkenuhsparebinatangofferwatchingbinigyangdevelopmentmemorywhyfindebroadcastpag-asamaalikabokmahalagatiktok,masaholkondisyonabalangperpektingliligawanmahigiteconomymagtatakaibabawpayapangrealnilalangsinungalingsalatinmaistorbobinatakdemocracylimoslokohinumiilingchadspeechdancenamungabackgabi-gabiisa-isamightmagpalagoalmacenarkasingtigaskumantasciencehandaanincitamenterpinunitsaannag-ugatnapasigawinterviewingrevolucionadotravelernaghihiraptalinopaulit-ulitbalinghihigittatloimbesmayamangpacepaaitinalijeepneymagawangvetodogsbeingcoughingusaelectionslcdataquespaghugosearncleartiyakayang-kayangnagsusulatlumakisarappambatangkapintasangpinauwibutiumaliskaugnayanuntimelyinterestssemillassantotrespaulsubalitnumerosascafeteriailogdingginevenhighestmediumclockinteractmessagenagkabungaenfermedades,napanoodanumanumiiyakmakabilimungkahimakapagempakeflyvemaskineremocionesbowlnabigyannunoailmentspalagiganidkasalanansukatreplacedlamesatransparentumarawcommerceyakapinnagreklamotumingalafamehulihantomorrowmanoodhinilaresortganagirayoverallgodyearspagkagustopioneerngipinnagpapaigibnaiilaganflexiblemahiwagasistemasibinili