Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Antiviral medications can be used to treat some viral infections, but there is no cure for many viral diseases.

2. Las vacaciones de invierno son un momento para descansar y pasar tiempo en familia.

3. Patuloy ang labanan buong araw.

4. Football is played with two teams of 11 players each, including one goalkeeper.

5. Musk's companies have been recognized for their innovation and sustainability efforts.

6. Bawat galaw mo tinitignan nila.

7. The ad might say "free," but there's no such thing as a free lunch in the business world.

8. Maluwag ang parisukat na sementong kinatitirikan ng gripo at ang dulo ng pila'y nasa labas pa niyon.

9. Ang magalang na tindero ay laging may malalim na respeto sa kanyang mga kostumer.

10. Ang paglapastangan sa mga kagamitan at ari-arian ng iba ay isang paglabag sa mga prinsipyong moral.

11. Sa mga lugar na mayroong tag-ulan, kadalasang tumataas ang presyo ng mga prutas at gulay dahil sa hirap sa pag-ani.

12. Tinigilan naman ni Ogor ang panunukso.

13. Some tips to keep in mind: Set a schedule for writing, it will help you to stay on track and make progress

14. Tila hindi pa tapos ang laban, kaya’t kailangan pa nating maghanda.

15. Sino ang binilhan mo ng kurbata?

16. May notebook ba sa ibabaw ng baul?

17. Los Angeles is considered the entertainment capital of the world, with Hollywood being the center of the film and television industry.

18. Ang mga sundalo nagsisilbi sa kanilang bansa upang protektahan ang kanilang kalayaan.

19. Members of the US

20. ¡Feliz aniversario!

21. Limitations are a part of life, and how one approaches and overcomes them can shape their character and experiences.

22. Ang Chinese New Year ay nagpapahayag ng pag-asa at pagbabago para sa bagong taon.

23. Les enseignants jouent un rôle important dans la réussite des étudiants.

24. Some people choose to limit their consumption of sweet foods and drinks for health reasons.

25. Sa kabila ng mga pagsubok, hindi siya sumusuko at pinagsisikapan na mapabuti ang kanyang buhay.

26. Ang buong kagubatan ay nagliliwanag sa tama ng mga ilaw ng parol ng mga Alitaptap.

27. The conference brings together a variety of professionals from different industries.

28. Sa tulong ng isang magandang pagsasalita at pang-unawa, ang tensiyon sa pagitan namin ay napawi.

29. Durante el invierno, se pueden ver las auroras boreales en algunas partes del mundo.

30. Sopas ang ipinabalik ko sa waiter.

31. Making large purchases without consulting your budget is a risky move.

32. Ang mga nanonood ay para-parang nangapatdan ng dila upang makapagsalita ng pagtutol.

33. Sa loob ng maraming taon, pinaunlad niya ang kanyang abilidad sa pagsasalita ng iba't ibang wika.

34. The United States has a capitalist economic system, where private individuals and businesses own and operate the means of production

35. Ang nagmamahal sa sariling bayan, kayang magtiis at magsumikap.

36. Maskiner er også en vigtig del af teknologi

37. Pumunta kami sa may bar ng bahay nila.

38. Si Emilio Aguinaldo ang pinakamatandang nabuhay na pangulo ng Pilipinas, na namatay sa edad na 94.

39. Lakad pagong ang prusisyon.

40. Nanalo siya sa song-writing contest.

41. She has excellent credit and is eligible for a low-interest loan.

42. Algunas serpientes son capaces de desplazarse en el agua, mientras que otras son terrestres o arbóreas.

43. La música puede ser utilizada para fines políticos o sociales.

44. Yeah. masayang sabi ni Chad with matching thumbs up.

45. La tos puede ser causada por una variedad de factores, incluyendo alergias, infecciones y enfermedades pulmonares.

46. La science est la clé de nombreuses découvertes et avancées technologiques.

47. Si Hidilyn Diaz ay tinawag na “Pambansang Bayani” sa larangan ng palakasan.

48. Tinig iyon ng kanyang ina.

49. Nag-aalinlangan ako sa aking desisyon dahil sa aking mga agam-agam tungkol sa magiging epekto nito sa aking pamilya.

50. Naghingi ako ng pabor at hiramin ang sasakyan ng aking kapatid para sa isang espesyal na okasyon.

Recent Searches

pakakasalanhonestohigh-definitiongenemagbayadstocksbigyandepartmentchangedturismoabatubigdi-kawasafacultyparaanledsandalimasyadongopomanggasocialesmalamanglumakasyumaosingaporekanyapusingnahulognagwelgalalabaspangungutyacuidado,universitiesnakakatulongpagtitiponcuentakrusthingvibratetumawaumalisngipinikawnapabalitasubalitbasahinbilinggamitlumitawmasarapnagalitsumunodkawayanmathmagpaniwalapakialamwaringbungagalingenvironmenthatinggabinagpaalamginhawabiglaankumembut-kembotsalapinabighanibriefmariatongmabangisnakasandigmailapmahinahongmabangohimutoklumilipadpagtataposalamjuicesparkdiningkaraokepabilimangyariallowsnabuhaymalakimatatalinoperpektodatimabutibakuransagotsinaliksiknakatayoanyomasayang-masayazamboangatumambadidiomakasiasawakumaripasbakatabaspabalingatibibigaytumugtogmaestroeuphoricikinakagalitagadikinagalitpunoservicesaninag-umpisamagta-trabahokapasyahanbumabagalaknag-alalasalamatlupabagkusumakyatbinigaymayorpangakosangkalanpabulongvictoriaumiiyaktheyagiladahilfoundhistoryminabutiseveralcameramahabamatapobrengmaasimpasasalamatmalabomaisdalawtomgayunmansementongpanitikan,todayikinatuwasimbahaspellingaeroplanes-allsuchkommunikererkeepgustoanotahimikabopagkagalitkinatitirikansuriinsinimulanmahabangpulangnangangalitpapagalitanatensyoncellphoneexpressionspalikuranbatang-batamaingaynagpatimplafremstillecreationkinisstalinomungkahiiniindaexpandedmang-aawitgalawgagambatinahakpayatmaistorbohumalakhakpersonstugonpasannakakapanunuksojobs