Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Ano ang natanggap ni Tonette?

2. Masarap higupin ang sinigang na may maraming gulay.

3. The team won a series of games, securing their spot in the playoffs.

4. Mahalaga rin ang pagkakaroon ng mga kaibigan sa panahon ng pag-iisa.

5. Algunos músicos famosos incluyen a Mozart, Beethoven y Michael Jackson.

6. Tinatawag niya ang anak ngunit walang sumasagot.

7. Gutom ka? kinagat ko ang labi ko at tumango sa tanong nya.

8. Sa gitna ng kagubatan, may matatagpuan kaagad na malalaking punong-kahoy.

9. Ibinigay niya ang kanyang panahon upang magbigay ng kaunting kasiyahan sa mga taong malungkot.

10. Tuwing Chinese New Year, nagtutungo ang mga tao sa mga templo upang magbigay-pugay.

11. La ganadería y el cultivo de pastos van de la mano en muchas explotaciones agrícolas.

12. Rendang adalah masakan daging yang dimasak dalam bumbu khas Indonesia yang kaya rasa.

13. Smoking can cause various health problems, including lung cancer, heart disease, and respiratory issues.

14. Ang diploma ay isang sertipiko o gawa na inisyu ng isang institusyong pang-edukasyon

15. Dalawang libong piso ang palda.

16. Wala akong pakelam, basta nasa ref ng bahay ko akin!

17. Ang pag-asa ay nagbibigay ng pag-asa sa mga taong mayroong mga pangarap at mga layunin sa buhay.

18. Saan na po kayo nagtatrabaho ngayon?

19. Sa harapan niya piniling magdaan.

20. Anong karangalan ang ibinigay sa kanya?

21. I hate it when people beat around the bush instead of just getting to the point.

22. Ibinigay ko ang aking karanasan upang matulungan ang aking mga kababayan na nangangailangan ng tulong.

23. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

24. We need to address the elephant in the room and discuss the budget issues.

25. "Laging maging handa sa anumang sakuna," ani ng opisyal ng gobyerno.

26. Nood tayong movie. maya-maya eh sabi niya.

27. Facebook Events feature allows users to create, share, and RSVP to events.

28. Mas masaya naman ako pag napapasaya kita eh.

29. The internet is full of April Fool's hoaxes and pranks - some are funny, but others are just mean-spirited.

30.

31. Ngunit wala siyang nararamdaman sakit.

32. Ant-Man can shrink in size and communicate with ants using his helmet.

33. Pano ba yan.. wala ng magkakagusto sa akin kasi mahina ako..

34. He realized too late that he had burned bridges with his former colleagues and couldn't rely on their support.

35. The United States is a global leader in scientific research and development, including in fields such as medicine and space exploration.

36. Kumain na tayo ng tanghalian.

37. Climbing without proper equipment is incredibly risky and dangerous.

38. Yumabong ang pagpapahalaga sa kalusugan ng mga tao dahil sa mga kampanya para sa mga aktibidad sa fitness.

39. Ang mga turista ay madalas magdala ng mapa para hindi maligaw.

40. Namamangha at nananaghili sa ganda ng magkakapatid ang mga dalaga sa kanilang nayon.

41. En España, la música tiene una rica historia y diversidad

42. Puno ng hinagpis ang liham na iniwan ni Clara bago siya tuluyang umalis.

43. Kapag mayroon kang kaulayaw, hindi ka mag-iisa sa mga pagsubok na iyong kinakaharap.

44. Paano mo pinalambot ang giniling na karne?

45. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

46. Naaksidente si Juan sa Katipunan

47. Cryptocurrency operates independently of central banks and governments.

48. The bird sings a beautiful melody.

49. En invierno, las personas disfrutan de bebidas calientes como el chocolate caliente y el té.

50. Kamu ingin minum apa, sayang? (What would you like to drink, dear?)

Recent Searches

katagahigh-definitionnag-umpisatapossinunodadditionbarung-barongbentangfredpistareadingtechnologicalmagtataasfilmkaraokeandroidcosechasultanmagdadapit-haponfurtherneedskaragatankakilalanahintakutanclubalisrumaragasangdiwatatinatanongiginitgitpag-aaralinalagaannalulungkotbantulothmmmipinansasahogkuyaeksenaunidosbilhanmasanaylondonkuwebaumakyatmissiontibigexpeditedparehasnatulakotherssumisidmasipagpondokumustakambingaregladoparoroonamusiciansmagdaankamakalawapinagsikapanpakikipagtagponaghandangculturapalipat-lipatnagtatakbonakapamintananapakahangaformsnaroondumagundongbestfriendnapaiyaknaguguluhangnakuhangsabadongnagpabayadnanghihinamangangahoytinaasanpagkuwanagsasagotkapatawarankarwahengnangampanyasalamangkeronamulatmagtigiladgangtawagyumabangpamumunopagpilimalapalasyounattendedmedikalmahinogkabutihannasasalinankare-karemakapalagpaglakinaibibigayhawlaconclusion,gagamitumiwaskoreaexigentemaibigaymaluwagnagsimulauniversitiessangaafternoonkapatagannanamankayonginhaleamuyinorkidyasfollowing,mabagaltumatawadtig-bebeintebasketbolgelaitinuturotelecomunicacionesnakabibingingpeksmanmadungisdiinmaghaponpagguhitpumilimagtatanimsistemasre-reviewisinuotpakaininsagottanawsumasaliwlalimunospagsidlansahodbusilakpinilitlaganapcoughingmatalimbanalmensrightspauwigustongvidtstraktdibapigingutilizarninonglimitedtambayananihinkarangalanmatulisaminsoundanakambagincidencenetflixkabuhayanvivamasilipcapitalingatanpalapiteducativasbotoasolegislationiniinomnakasuotgagmalakialamidbansangtinitirhansawalandemalihisbigyan10thanimoformassoonipinabalik