Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. The bookshelf was filled with hefty tomes on a wide range of subjects.

2. The company is exploring new opportunities to acquire assets.

3. TikTok has inspired a new wave of viral challenges, from dance routines to lip-syncing.

4. Pardon me, but I don't think we've been introduced. May I know your name?

5. Lumibot siya sa buong paligid ng ospital upang alamin ang mga pasilidad na maaaring magamit ng kanilang pasyente.

6. Sa kasal, ang mga dalagang kasama ng bride ay nagdadala ng mga bulaklak at kumakanta.

7. Hindi ako sang-ayon sa mga pahayag ng ilang mga personalidad sa social media.

8. Salatin mo ang ibabaw ng mesa para makita kung may alikabok.

9. Hanggang maubos ang ubo.

10. Si Rizal ay kilala rin sa kanyang pagmamahal sa kanyang bansa at sa kanyang mga kababayan.

11. The power of a single act of kindness can be immeasurable in its impact.

12. Sa loob ng bilangguan ay doon rin niya nakilala ang isang pari, si Padre Abene

13. Nilinis namin ang bahay kahapon.

14. Shows like I Love Lucy and The Honeymooners helped to establish television as a medium for entertainment

15. Hindi ako komportable sa mga taong nagpaplastikan dahil alam kong hindi nila ako tunay na kakampi.

16. Ang takip-silim ay isang magandang panahon upang magpahinga at magrelax mula sa mga pagod ng araw.

17. El trabajo de parto puede durar varias horas o incluso días, dependiendo del caso.

18. Lumipat si Carlos Yulo sa Japan upang mas mapalakas ang kanyang training sa gymnastics.

19. The United States is a leader in technology and innovation, with Silicon Valley being a hub for tech companies.

20. Ang kanyang natatanging abilidad sa musika ay nagdala sa kanya sa internasyonal na kasikatan.

21. Women have been subject to violence and abuse, including domestic violence and sexual assault.

22. She learns new recipes from her grandmother.

23. Platforms like Upwork and Fiverr make it easy to find clients and get paid for your work

24. Ang kalawakan ay punung-puno ng mga bituin.

25. Musk has been named one of the most influential people in the world by TIME magazine.

26. Børn skal beskyttes mod vold, misbrug og andre former for overgreb.

27. Botong boto nga sayo ang mga magulang ko eh.

28. En zonas áridas, el cultivo de cactus y suculentas es una opción popular.

29. Galit na galit ang ina sa anak.

30. Hindi ko nakita ang kubyertos sa lamesa, kaya nagtanong ako sa waiter.

31. Jennifer Lawrence won an Academy Award for her role in "Silver Linings Playbook" and is known for her performances in the "Hunger Games" series.

32. Ang lakas ng ilaw ng kanyang flash light.

33. La creatividad es fundamental para el desarrollo de ideas innovadoras.

34. Noong unang panahon may nakatirang mag-ina sa isang malayong pook.

35. On dit souvent que l'argent ne fait pas le bonheur, mais il y contribue grandement.

36. Inflation kann auch durch eine Erhöhung der Nachfrage nach bestimmten Waren und Dienstleistungen verursacht werden.

37. Landet er hjemsted for en række store virksomheder, der eksporterer til hele verden

38. Masyadong mahal ang kanyang gustong bilhin, samakatuwid, naghanap siya ng mas murang alternatibo.

39. Dumating ang pangulo sa pagtitipon.

40. Wala naman akong sinabing ayaw ko ah?

41. Ang pagbisita sa mga magagandang tanawin o pook turistiko ay isang nakagagamot na paraan upang mabawasan ang stress.

42. When we read books, we have to use our intelligence and imagination.

43. Hockey requires a lot of stamina, with players skating for extended periods of time without stopping.

44. Ang carbon dioxide ay ina-absorve ng mga puno.

45. Hoy bakit, bakit dyan ka matutulog?

46. Natutuwa ako kapag nakakakita ako ng isang halamanang mayabong sa mga pampublikong lugar.

47. "Wag kang mag-alala" iyon lang ang sagot ng dalaga sa kanya

48. Alangan ako?! Ako na nga unang nagbigay eh! Ikaw naman!

49. Alam ko.. sinabi niya sa akin yun..

50. Bawal magpapakalat ng mga fake news dahil ito ay nagdudulot ng kaguluhan at kawalan ng tiwala sa media.

Recent Searches

high-definitiondibaiconsjenaprusisyonmanghuligiverpsssaffiliatemaaliwalasnakainihandanaiinitanmulighedermaidtoybateryaimagessalataksidentesoundlarongabangananihinbulaksultanadditionally,knightrisewaterproudmatabangcniconetflixenergililychickenpoxskyldeshikinginakyatorganizematigassusinamasumingitasiaticfathertibigangaltokyocubicleexpertiseconsistdiamondomelettesnobrabejudicialusapinatidramdamisiprailwaysteleviewingubodmaluwangpanayfuelgreatawapopularizebranchsantoguhitisaacamparoburmalossduonpeacekaymakisigcellphonebotolegislationhouseibonkabosessinagotlingidbeganprincecalciumitinagotinderapulubimrspalapittapatganasupremeamotradewarimedidaalexandercinetransmitspangitmorenagooglefreelancerchadlaterestawannatingalaabenefeelreducedjaneso-calledmatindingsparkofficetanimperlaglobaljackztrafficgabetryghedfakefertilizerabikwebangotrasmaalogmoodoverallzoomsumasambalimossumusunomasdansystematiskexammalagoscientificspeechesdinalawcommissionmaitimulampostcardlamesaearncollectionshangaringsufferumingitasulstillahiteffortskamatissweetorugastapleclaseshelpfulkasinggandabornlorenaidea:ratetwinkledumatinglivepaslittabashalamanpollutionsumapitspeedategracepupuntapostergameworrydelediniexpertdaangsumangmapakaliperangexperiencesbinabaanpede