Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Ang abilidad sa pangangalaga ng kalusugan ay mahalaga upang mapanatili ang malusog na pamumuhay.

2. Emphasis can also be used to create a sense of urgency or importance.

3. My favorite restaurant is expensive, so I only eat there once in a blue moon as a special treat.

4. Limitations can be addressed through education, advocacy, and policy changes.

5. The company is exploring new opportunities to acquire assets.

6. Nagtayo ng scholarship fund si Carlos Yulo para sa mga batang gustong mag-aral ng gymnastics.

7. Basketball is a team sport that originated in the United States in the late 1800s.

8. Mi amigo es muy bueno con las palabras y siempre me ayuda con mis discursos.

9. She has excellent credit and is eligible for a low-interest loan.

10. Technical analysis involves analyzing past market trends and price movements to predict future market movements.

11. Mahiwaga ang espada ni Flavio.

12. Mawala ka sa 'king piling.

13. Ginamit nya sa pangungusap ang mga sumusunod na salita.

14. Baby fever can be accompanied by increased attention to one's physical health and well-being, as individuals may want to ensure the best conditions for conception and pregnancy.

15. Ang mga manggagawa nagsisilbi sa kanilang kumpanya upang magtrabaho at kumita ng pera.

16. We need to get this done quickly, but not by cutting corners.

17. Beauty is in the eye of the beholder.

18. Ngunit kahit ganyan ang kinalalagyan.

19. The website's design is sleek and modern, making it visually appealing to users.

20. Pumila sa cashier ang mga mamimili nang limahan.

21. He does not break traffic rules.

22. Magkaiba ang disenyo ng mga blusa namin.

23. Maraming tao ang nagpaplastikan sa harap ng ibang tao para lang mapasama.

24. Ah ganun ba sabi ko habang naka tingin sa cellphone ko.

25. Nariyan sa kahon ang kamiseta mo.

26. The United States is a leader in technology and innovation, with Silicon Valley being a hub for tech companies.

27. Eine Inflation von 2-3% pro Jahr wird oft als normal angesehen.

28. The city hosts numerous cultural festivals and events, celebrating different traditions and communities throughout the year.

29. El nacimiento de un bebé es un momento de felicidad compartida con familiares y amigos.

30. Kanina sabi mo joke, ngayon example. Ano ba talaga?!

31. Sa di-kawasa ay dumating ang malungkot na sandali.

32. Ang oxygen ay kailangan ng tao para mabuhay.

33. Kinabukasan ay nawala si Bereti.

34. Morgenstund hat Gold im Mund.

35. The scientific method is used to ensure that experiments are conducted in a rigorous and unbiased manner.

36. Sayang, tolong maafkan aku jika aku pernah salah. (Darling, please forgive me if I ever did wrong.)

37. Ang laki ng pinanalunan nila sa lotto.

38. His charitable nature inspired others to volunteer at the local shelter.

39. Børn er en vigtig del af samfundet og vores fremtid.

40. Si Carlos Yulo ang unang Filipino gymnast na nakakuha ng gintong medalya sa World Championships.

41. Paulit-ulit na niyang naririnig.

42. Hindi dapat nating pabayaan ang ating mga responsibilidad sa buhay, samakatuwid.

43. The culprit behind the hit-and-run accident was later caught and charged with vehicular manslaughter.

44. ¿Quieres algo de comer?

45. Hendes livsstil er så fascinerende, at jeg ønsker at lære mere om hende. (Her lifestyle is so fascinating that I want to learn more about her.)

46. No puedo creer que ya te vas, cuídate mucho y no te olvides de nosotros.

47. Ang pagkakaroon ng sariling realidad na hindi nakabatay sa mga katotohanan ay nagpapakita ng pagiging bulag sa katotohanan.

48. Laughter is the best medicine.

49. If you think I'm the one who broke the vase, you're barking up the wrong tree.

50. Twinkle, twinkle, little star.

Recent Searches

high-definitioninvitationinangbinibiliapologeticartistaabaladinalaworugateleviewingexcusemasasakittaasmatindilabanmaalogpingganmalagofakepahabolkantopuedesalexandertapeisangtogetherlulusogespecializadasconcernshumanosintroducemadungissanggolumaalismakespracticesfatal2001graduallypitakaginooislabulathereforeeveningstrengthmatangkadcreatestyrerpublishedpackaginggagawinpaderaraw-arawnanunuksopakainpaladrosaskapaincornerssinulidmatagpuankarunungantuyoinspirekalalakihanpartykunekinalakihandapit-haponpagtutolpakibigaykaarawandidtelamanyhagdananpatakbopisngipagiisiphalakhakparusahanmaiingayroomnauliniganrequirecomunicarsemiraekonomiyatechnologicalskyldes,whynakaitutolomeletteluboscitizensnyegamotbigpagamutannagdasalmisteryojunjunpatalikodmahigpitsinalansantuloggodtsandwichculpritdiincuandosahodmind:pinagkaloobankawawangenfermedades,namumukod-tangimakalaglag-pantybaranggaynagbakasyonkumakalansingnagngangalangdistansyanapakasipagmonsignorhila-agawannapapatungomakikiraantapatnagtalaganasiyahankabundukanmalambotbusinessesomfattendeuniversitiesipinangangakmaluwagdumadatingrenacentistapagsayadnaiisipnanamantamarawcombatirlas,nationalhayoplumindolkontinganghellayawquarantinegownnatitiraindiaapoynogensindesinebevareresignationblazingfreedeterioratelandoasthmasukattinglegendssubjectmoodavailablegandatomarayudaconvertidasnatingalatopic,ofteforskel,palagingfloorreservedgenerabaquicklymonetizingbadhalikafarcellphoneprutasnaglinispatulogkalandumalojolibeehinogcomputerformat