Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Nang mabangga ang kotse, kumaripas ang driver para umiwas sa responsibilidad.

2. Tila siya ang paboritong estudyante ng guro.

3. Elvis Presley's life and career are a fascinating story of a young man who rose from humble beginnings to become one of the biggest stars in the world

4. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

5. Los héroes defienden la justicia y luchan por los derechos de los demás.

6. True forgiveness involves genuine empathy and a willingness to see the humanity and potential for change in others.

7. Ang kanyang negosyo ay lumago nang husto, samakatuwid, nakapagbukas siya ng panibagong branch.

8. Maglalakad ako papunta sa mall.

9. Napagalitan si Juan dahil na-suway siya sa paglabag sa traffic rules.

10. In the early days, telephones were connected to a central switchboard, which connected calls manually

11. Subalit pinipilit pa rin niyang maging malakas bagamat talagang di na kaya ng kaniyang pang tumayo ng kahit ilang sandali man lang.

12. Dapat natin kontrolin ang pagmamalabis sa paggamit ng social media upang hindi ito makaapekto sa ating mental na kalusugan.

13. Sa sobrang lamig ng tubig, hindi ko magawang salatin ito nang matagal.

14. May salbaheng aso ang pinsan ko.

15. At blive kvinde handler også om at lære at håndtere livets udfordringer og modgang.

16. Mas mabuti pang magpakatotoo at huwag maging masyadong kababaw sa mga bagay.

17. Mahalagang magpakatotoo sa pagpapahayag ng financial status upang maiwasan ang pagkakaroon ng maraming utang.

18. Ang pagsasama ng pamilya ay isang nakagagamot na karanasan na nagbibigay ng tunay na kaligayahan.

19. Los padres sienten un inmenso amor y conexión instantánea con su bebé desde el momento del nacimiento.

20. Los héroes a menudo arriesgan sus vidas para salvar a otros o proteger a los más vulnerables.

21. Gumagawa ng cake si Bb. Echave.

22. Terima kasih banyak! - Thank you very much!

23. Ang magnanakaw ay nasakmal ng aso ng may-ari habang tinutukan siya ng baril.

24. She has been cooking dinner for two hours.

25. Lucas.. sa tingin ko kelangan na niyang malaman yung totoo..

26. He was busy with work and therefore couldn't join us for dinner.

27. The museum offers a variety of exhibits, from ancient artifacts to contemporary art.

28. Ang pagkakaroon ng karamay at suporta mula sa mga mahal sa buhay ay makatutulong upang malunasan ang pangamba.

29. Seeing a favorite band perform live can create a sense of euphoria and excitement.

30. Dahil sa tagumpay ni Hidilyn Diaz, mas maraming Pilipino ang nagkaroon ng interes sa weightlifting.

31. Este plato tiene un toque picante que lo hace especial.

32. Disyembre ang paborito kong buwan.

33. Ang mag-asawa ay may hanapbuhay na paghahabi ng mga tela.

34. Ang Chinese New Year ay nagpapahayag ng pag-asa at pagbabago para sa bagong taon.

35. Pag-ibig na palaisipan, sa kanta na lang idaraan

36. Oh ano na? Hindi ka na sumagot?

37. Las labradoras son excelentes perros de trabajo y se utilizan a menudo en búsqueda y rescate.

38. Hinikayat ang mga turista na lumibot sa mga nakakaakit na tanawin ng naturang isla.

39. Naging kasangkapan ng mga Espanyol ang Katolisismo upang lalong mapadali nila ang pamamalakad dito.

40. Anong buwan ang Chinese New Year?

41. La diversificación de cultivos ayuda a reducir el ries

42. Ano ang pangalan mo? ang tanong niya sa bata.

43. Nous avons embauché un DJ pour animer notre soirée de mariage.

44. ¡Buenas noches!

45. The value of cryptocurrency can fluctuate rapidly due to market forces.

46. Kailangan kong magtiwala sa aking sarili upang maalis ang aking mga agam-agam.

47. Ang mga hanging taniman ng mga orchid ay gumagawa ng isang maganda at mayabong na tanawin.

48. Marami sa atin ang may mga pangarap sa buhay na nais nating tuparin.

49. Maraming bayani ang nakalikha ng mga bagong teknolohiya at kaisipan na naging pundasyon ng progreso ng bansa.

50. La anaconda verde es una de las serpientes más grandes del mundo y es conocida por su capacidad para aplastar a sus presas.

Recent Searches

balanghigh-definitionburgerplaceisugaprimersinunodsweetfuecompostelalossrailwaysdiamondlingidfreemayroonradiomaislagikanankanilabuwalavailablevoteslabingbirodurisumakitthenrailriskconvertidasreducedbugtongbienbasahantanimerapinalalayanstonehamtsaaforcespalaginginislosmanuelsumaliconsideredbellbumugamillionsmulioutpostsorrydedication,maasiminternetalas-diyesslavebadingipongbroadmovinglibrepracticadoauditlastingatenagingdrewfinishedfloorspadragonwalletprogressdatashiftgeneratedneedsdoinginitbackwhetherelectbilingpilingsummitcontinuedappconaregladomaipantawid-gutomlagaslastodomarunongtilaterminotanawkuryenteshapingbakadancejacetumakashatinggabimanahimikwaringikinasasabikipinadalaspiritualmakapangyarihangnakapagreklamoginugunitakomunikasyonmagbabakasyonnanghahapdipunongkahoynakakadalawagwadormagta-trabahopinagmamalakibiocombustiblesgumagalaw-galawdapit-haponnahawakanpagpapasanmamanhikankalayaanpapanhikmagpaliwanagalikabukinkikitanagwelgamagkaibapaghalakhaknapapatungomagkaparehonaka-smirknagtatampotinatawagmakikiraannagmakaawamagkaibiganpatutunguhanmagnakawnagpepekemagpagalingnakuhangbiologinakaririmarimmahiwaganghinawakanbinibiyayaanpinakamahabatatlumpungluluwascultivarnanlilisikmanggagalingbloggers,ika-12tumaposkaliwakagubatanevolucionadotinungonagbentamagsisimulahinahanapgumuhittaga-ochandotumamisumigtadmauupotissuenaliligomarangalincitamenterhehekwebapagbebentaipatuloylegislationmakaratingletterpinapanoodpulubimakasarilinggamekapagcondolabahinespadaspendingtargetdevicesitakextrafour