Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Natawa kami sa inasta ni Sara dahil para siyang bata.

2. El teléfono también ha tenido un gran impacto en la forma en que las empresas se comunican con sus clientes

3. Biglang dumating ang araw ng kanyang pagsusulit, naging abala si Nicolas sa kanyang pag-aaral kaya hindi siya nakakasulat at nakakadalaw sa dalaga.

4. The pneumonia vaccine is recommended for those over the age of 65.

5. Pets, including dogs, can help children develop empathy and responsibility.

6. Claro que puedo acompañarte al concierto, me encantaría.

7.

8. Kanina ka pa? tanong ni Aya sa akin.

9. Sadyang mahirap ang pag-aaral ng calculus.

10. Las hojas de afeitar deben cambiarse con frecuencia para evitar irritaciones en la piel.

11. Naalala ni Mang Kandoy ang abo ng puso ni Rodona na kanyang itinago.

12. Inflation kann auch die Sparquote verringern, da das Geld weniger wert wird.

13. Their primary responsibility is to voice the opinions and needs of their constituents.

14. I know I'm late, but better late than never, right?

15. Iginitgit ni Ogor ang bitbit na balde at kumalantog ang kanilang mga balde.

16. Mabuti na lamang at nandyan ang kanyang kaibigan.

17. The birds are not singing this morning.

18. Bilang paglilinaw, ang impormasyon ay nakuha mula sa opisyal na website, hindi sa social media.

19. Las plantas perennes viven durante varios años, renovando sus hojas y flores de forma periódica.

20. At kombinere forskellige former for motion kan hjælpe med at opnå en alsidig træning og forbedre sundheden på forskellige måder.

21. May mga nagpapaputok pa rin ng mga paputok sa hatinggabi kahit bawal na ito.

22. Les sciences sociales étudient le comportement humain et la société.

23. Sa facebook kami nagkakilala.

24. Naglabanan sila upang makita kung sino ang tatagal at mananaig.

25. Les dépenses publiques peuvent avoir un impact significatif sur l'économie.

26. Madali naman siyang natuto.

27. Vielen Dank! - Thank you very much!

28. Ganun? ok. disappointed na sabi ko.

29. Handa na bang gumala.

30. Malapit na ang araw ng kalayaan.

31. Some couples choose to have a destination wedding in a different country or location.

32. Sa tahanan, ako'y nakatulog nang matiwasay sa aking malambot na kama.

33. Smoking can cause various health problems, including lung cancer, heart disease, and respiratory issues.

34. Nationalism can be a source of inspiration for artists, writers, and musicians.

35. Russell Westbrook is known for his explosive athleticism and ability to record triple-doubles.

36. Mi novio me sorprendió con un regalo muy romántico en el Día de los Enamorados.

37. At være transkønnet kan være en del af ens identitet, men det definerer ikke hele personen.

38. Tendremos que tener paciencia hasta que llegue nuestro turno.

39. The Hollywood Bowl is an iconic outdoor amphitheater that hosts concerts and live performances.

40. Seeking support from friends, family, or a mental health professional can be helpful in managing feelings of frustration.

41. In recent years, the telephone has undergone a major transformation with the rise of mobile phones

42. Nagkaroon sila ng maraming anak.

43. Ang buhay ko ay hindi na magtatagal, habang ako ay may kapangyarihan pa, binibiyayaan ko kayo ng iyong asawa ng isang anak..

44. Marurusing ngunit mapuputi.

45. Congress are elected every two years in a process known as a midterm election

46. Kailangan nating magfocus sa mga bagay na may kabuluhan at hindi sa kababawang mga bagay sa buhay.

47. Las escuelas privadas requieren matrícula y ofrecen diferentes programas educativos.

48. Bawal mag-drugs dahil ito ay nakakasama sa kalusugan at nakakadulot ng krimen.

49. Dapat tayong mag-ingat sa sobrang pangamba dahil ito ay maaaring makaapekto sa ating kalusugan.

50. Nous avons choisi une chanson spéciale pour notre première danse.

Recent Searches

high-definitionkinantamorenaginoongpanindaipinikitsuelosabihingdoktorlupainadditionunderholderlutodiamondschedulekatabingproperlyaudio-visuallyulamtinulunganboksingditointernettruegrabeumaagossynctinitignanexiststopseparationi-rechargehinawakannakaririmarimmasayang-masayauulaminhurtigerexixinagawlagnatsikatdalawangphonematitigasdivisioninaleegnatitirababeumingitkamandagdrogafilmarmedsikonilolokodiretsonutspaglalabadanegosyantemagsusunuranpagkataomagawangideyagayunpamansasamahantumambadpinag-aaralanipinatawmagsi-skiingpagdukwanglarawandintinderaalwaysbakatreatsadmiredpagkaraapagtatanimpagkatakotmagkaibangmovietumatakbopresentationpublicationestasyonsasakaynangangakomaibibigaybihirahinagisnatatanawrodonaibat-ibangeconomicmakatifreedomskaunticombatirlas,payongrolandsiguropesosrealwasakmaramingforståestilosmaisipganatapatyourself,yatasufferipinadalatinanggapmenosmisasparkkerbburgerirognaritocornersmajoreducationalatagodpangulopinahalataresourcespopcornbehalfmovingorderdulodelethreeclientesmagbubungakumembut-kembotnakikini-kinitamayabangikinakagalitnagliliyabpagka-maktolnakabulagtangbusilaknagsisipag-uwianwalkie-talkieavailablematutongnagkakasyakagalakanibinubulongisinulatmagasawangbusiness,ngingisi-ngisingressourcernenapakatalinonakaluhodnaglabanandoble-karahampaslupaaktibistaflyvemaskinermiyerkoleskinikilalangglobalisasyonnagandahanmakangitiengkantadangpaghahabipagkaangatmensahekinasisindakanaplicacionespagsisisipagtataaspundidostaymagkanomarketing:palamutimagamotcualquiermiyerkulespakinabanganaskparagraphsdaangnag-away-awaymarasigandropshipping,siksikannagdabogmanirahannangyari