Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Tila may pagdududa siya sa katapatan ng kanyang kaibigan.

2. Madali naman siyang natuto.

3. Nasa Montreal ako tuwing Enero.

4. Samantala sa pamumuhay sa probinsya, natutunan niyang mas ma-appreciate ang kagandahan ng kalikasan.

5. Nagsusulat ng pangungusap ang mga estudyante.

6. Puwede ka ring magguhit ng mga larawan ng kalikasan upang magpakita ng pagmamahal sa ating planeta.

7. Sa kanyang pagbabasa ng libro, biglang napadungaw ang kanyang mata sa isang nakakatuwang larawan.

8. Maganda ang mga bulaklak sa tagsibol.

9. Alam niyang maganda talaga ang dalaga at hindi totoo ang sinabi niya.

10. Ang mommy ko ay masipag.

11. La película que vimos anoche fue una obra sublime del cine de autor.

12. Mula noong nakilala kita, hindi ko maalis sa isip ko na crush kita.

13. I love you, Athena. Sweet dreams.

14. The acquired assets included several patents and trademarks.

15. Al elegir un powerbank, es importante considerar la capacidad de la batería, el tamaño y la compatibilidad con los dispositivos que se cargarán.

16. Vivir en armonía con nuestra conciencia nos permite tener relaciones más saludables con los demás.

17. Cheating is not always intentional and can sometimes occur due to a lack of communication or understanding between partners.

18. Nagdulot ng kakulangan sa tubig ang matagal na tagtuyot sa kanilang lugar.

19. Nag-aaral ang estudyante sa laybrari.

20. Ang aking kaulayaw sa kanto ay nakatulong sa akin sa paghahanap ng trabaho.

21. Ano ho ang gusto ninyong orderin?

22. It was supposed to be a surprise promotion, but the boss let the cat out of the bag during a meeting.

23. Kumain ako ng macadamia nuts.

24. Fødslen kan også være en tid med stor frygt og usikkerhed, især for førstegangsforældre.

25. He has traveled to many countries.

26. Me encanta enviar tarjetas de amor en el Día de San Valentín a mis amigos y seres queridos.

27. Kumaripas ng takbo ang kabayo nang bumitaw ang sakay nitong tao.

28. Ang aking anak ay madalas manood ng Baby shark sa youtube.

29. Lumakad ako nang mag-isa sa madilim na daan at nagitla ako nang biglang may humawak sa aking balikat.

30. Kinuskos niya ang kanyang buhok at nabasa pati ang kanyang anit.

31. Ang paglalakad sa kalikasan at pakikisalamuha sa kalikasan ay nakagagamot sa aking isip at katawan.

32. She is designing a new website.

33. Kung may gusot, may lulutang na buhok.

34. Tesla has faced challenges and controversies, including production delays, quality control issues, and controversies surrounding its CEO, Elon Musk.

35. Nagsisilbi siya bilang public servant upang matugunan ang pangangailangan ng kanyang nasasakupan.

36. Sa paligid ng balde, nakikia niya ang kanyang anino.

37. Hun er utrolig smuk. (She is incredibly beautiful.)

38. Ang nagbabago ay nag-iimprove.

39. Tara! Sumama ka sa akin para makita mo kung gaano sila kaganda

40. Some viruses, such as the common cold and flu, can cause mild symptoms, while others, like HIV and Ebola, can be deadly.

41. En god samvittighed kan være en kilde til personlig styrke og selvtillid.

42. Bumagsak ang nawalan ng panimbang na si Ogor.

43. Walang telebisyon sa kuwarto ni Fiona.

44. Marahil ay malamig ang klima sa bundok sa panahon ngayon.

45. Nagreklamo ako tungkol sa pakete ko.

46. Ngunit walang maibigay ang mga tao sapagkat salat din sila sa pagkain.

47. Taga-Hiroshima ba si Robert?

48. Gaano katagal ako maghihintay sa bus?

49. Hockey can be a physically demanding and challenging sport, but it can also be a lot of fun and a great way to stay active.

50. Tumamis at sumarap ang lasa ng bunga.

Recent Searches

high-definitionisdacapitalkatandaannakapuntainterestskagandahaynakaimbakorugapostcardpaskobuwannumerosasinasahigrestawansparkfraipagbilileyteabonofigureipantalopoutsciencenaritoumiinitkitangoutlinesreportpapuntaroleeveningplaysangneromagtatanimpadabogandamingmotionaggressionmagbubungaeveryanimdingginnasundobwahahahahahasizeprogramsprogramminglibrocuandocirclecontrollednagsimulainstrumentalmagsasalitabaliwnakapamintanapasyentedinpassionactivitynagsisigawnagbigayanswimminganjophilippinepagiisipbunutankakaibangmagkasinggandalaamangnasanmelissahumblegamotsupremekaliwasitawjennyorderlabananauthoribababulsasedentarynogensindebatayindustriyaenfermedades,kitang-kitasarongnabigaybayanipakilagaytanghalihinalungkatrabbadespuesnapapatinginsandalingtagaktayomagpapabakunaniliniscryptocurrency:busyangdawlayaspartysetyembrepasensyamatabangsusikatagalanstaynamuhaymangyarinakatuonmanghikayatprotestaberegningerstrategynangangahoytuluyannasabinghaliplabinsiyamtrainskontinentengfotosginangpeternanakawanfullmakikiraannakatayolumalakikilalamakikipaglaropamburaiiwasanlikodvigtigstenagpipiknikitinaliminu-minutoumiinomshiftgivermahiwagangikinamataymakatarungangkamaoerlindamininimizemaynilaatpinamalagikasintahanmaghahatidtelevisedpalantandaandisfrutarsobrakumirotnakakapamasyalwriting,remainngisisukatdecreasedhigantemalilimutanbiologimalayanagsunuranregaloomfattendeobtenertindalumitawuulamintatlongpromotingvisualduranteprimerasmukhangparusaosakatumawagdogshayaanbetanatatanawnagpasyatulogkonsentrasyon