Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Hiram na libro ang ginamit ko para sa aking research paper.

2. "Ang pera ang ugat ng lahat ng kasamaan" ay isang bukambibig na nagsasabing ang pagkakaroon ng pera ang dahilan ng iba't ibang problema sa mundo.

3. Anong oras mo ako ihahatid sa airport?

4. Dapat nating isaalang-alang ang mga posibilidad ng bawat desisyon, datapapwat ay hindi natin alam ang mga mangyayari sa hinaharap.

5. Ang mga punong-kahoy ay hindi lamang maganda

6. Menghadapi tantangan hidup dengan keberanian dan tekad dapat membantu kita tumbuh dan mencapai tujuan yang kita impikan.

7. Napakainit ngayon kaya't kinailangan kong nagiigib ng malamig na tubig para sa sarili ko.

8. Bumili sila ng bagong laptop.

9. Ang kamalayan sa kanyang pangalan at nagawa ay naging inspirasyon para sa maraming henerasyon ng mga Pilipino.

10. Ikaw ay magiging isang nilalang sa karagatan.

11. Ang obra maestra ay gawa ng mga tao na mayrroong malawak na imahinasyon

12. Bumili si Ana ng regalo para diyan.

13. Las hojas de eucalipto se utilizan a menudo para aliviar la congestión nasal.

14. Inalagaan ito ng pamilya.

15. Einstein's legacy continues to inspire and influence scientific research today.

16. Bitte schön! - You're welcome!

17. Nagtawanan kaming lahat sa hinirit ni Kenji.

18. The website has a section where users can leave feedback and suggestions, which is great for improving the site.

19. The basketball court is divided into two halves, with each team playing offense and defense alternately.

20. Natutunan ng mga mag-aaral ang talambuhay ni Melchora Aquino bilang isang "Ina ng Himagsikan."

21. Haha! Who would care? I'm hiding behind my mask.

22. Beauty! yumakap pa mula sa likod ko si Maico.

23. Naramdaman ko ang kanyang halinghing sa aking tainga dahil sa sobrang lalim ng kanyang paghinga.

24. Ang dami nang views nito sa youtube.

25. The Lakers have a rich history and are one of the most successful franchises in NBA history.

26. Microscope lenses must be kept clean and free of debris to avoid distortion and other imaging problems.

27. Palibhasa kaaya-ayang pagmasdan ang magandang mukha ng anak nila na pinangalanan na Aya.

28. Known for its sunny weather, Los Angeles enjoys a Mediterranean climate throughout the year.

29. Algunas culturas consideran a las serpientes como símbolos de sabiduría, renacimiento o incluso divinidad.

30. La paciencia nos ayuda a controlar nuestras emociones.

31. Baka puwedeng hiramin mo ang iyong sasakyan para sa isang biyahe.

32. Malikot ang kanyang mga mata nang siya'y bumangon at itukod ang mga kamay sa semento.

33. Masakit ba ang lalamunan niyo?

34. Ang pangamba ay isang emosyon na karaniwang nararamdaman ng mga tao kapag mayroong posibilidad ng panganib.

35. Umayos naman ako ng higa at yumakap patalikod sa kanya.

36. Mataas sa calcium ang gatas at keso.

37. Sa huling pagkakataon ang mga isda ay nagsalita.

38. He gives his girlfriend flowers every month.

39. Ang aking ina ay isang magaling na mananahi.

40. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

41. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

42. Buti naman. Ayoko mahawaan ng kuto eh.

43. Malamang na tamaan ka pa ng kidlat.

44. Ang bobo naman ito, di pa nasagutan ang tanong.

45. Makapangyarihan ang salita.

46. Abraham Lincoln, the sixteenth president of the United States, served from 1861 to 1865 and led the country through the Civil War, ultimately preserving the Union and ending slavery.

47. Saan ka galing? bungad niya agad.

48. The Northern Lights, also known as Aurora Borealis, are a natural wonder of the world.

49. Umiling lang ako bilang sagot saka ngumiti sa kanya.

50. The development of vaccines and antibiotics has greatly reduced the incidence of infectious diseases, while the use of medical imaging and diagnostic tools has improved the accuracy and speed of diagnoses

Recent Searches

high-definitionprogramsmagsimulapangangatawantaperefginisingnathanorugamabilissetsdecreasenagpalutopagkaingamongnatagalankontinentengbumabaha1876content,bellmagtatakakalalarohinatidarkilavampiresinomlingidbernardonagtakapogidaddymauuponangingilidideasisuboganapincanadapinapasayapinabayaantransportkaninumanpicsroofstockcompaniesartistasborgerecurtainsasukaldahilmabihisanroonpagkabigladyipnipaglakinakatuonpinagpatuloysisikatbevareipinapagtatanongdrinkinilistamasasayakonsentrasyonbrancher,bundokregulering,inasikasopakakatandaanpalabuy-laboymakinangpelikulanakakatawamarangalnerotuluyaneveningpagsasalitanangagsipagkantahanlasongmakasakayfascinatingkidlatubodkagubatanadmiredkissadicionalestanyagmobilenatayomagisingyelonagpalalimnandiyantanghalieffortsmisyunerongcuandomakabawiginangtabatag-arawdawsakaylegacypagsalakaypalagiipagamotpagbebentanagbababanaguusapexhaustedproducirhapasinunderholderinfluentialspeechestambayanunti-untiginawaranflymind:pag-iwannakikitadibapodcasts,mabaitbecomeritopinaghatidanlalakepaghihingalosayawasteiilanmagdamagtandapowergatasalwaysnakalipaszoomagpagalinggumigitiiwasiwasconectantawanangreenhillsdangerouszebrabugtonglamigkontrataadoptedtumubozamboangadisappointedtradisyonlistahanelectoralteknologinangingitngitpanindapanghihiyangvidenskabmumuraindividualmangkukulamgayunmanpokernasagutanchickenpoxlaki-lakihimayintaga-hiroshimapinangalanankamakailansnobbobojudicialsamufansnaglipanangpuntahannangahasnasiyahannakatapatsalbahengmatigaspinangalanangtonyobotecablepssssementeryobalahibogoodeveningdemocratic