Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1.

2. Sweetness is a sensation associated with the taste of sugar and other natural and artificial sweeteners.

3. Maraming lumabas na balita ukol kay Pangulong Manuel L. Quezon.

4. Ang mainit na tasa ng tsokolate ay animo'y nagbibigay init sa malamig na gabi.

5. Ang tubig-ulan ay nagbibigay ng mga oportunidad para sa mga aktibidad tulad ng paglalaro sa ulan, pagsusurfing, at iba pa.

6. May bago ka na namang cellphone.

7. Ang mga tao sa mga lugar na madalas tamaan ng buhawi ay kailangang maging handa sa mga emergency evacuation plan at mabilis na pagkilos.

8. Payat na payat na ang ama't ina niya para matustusan ang kanyang pangangailangan.

9. Les dépenses publiques peuvent avoir un impact significatif sur l'économie.

10. Pagdating namin dun eh walang tao.

11. Don't waste your money on that souvenir, they're a dime a dozen in the market.

12. Nais sanang magbago ng isip si Magda, ngunit nanaig ang kanyang pagkagusto kay Damaso.

13. Sang-ayon ako na dapat natin pagtuunan ng pansin ang kalagayan ng ating kalikasan.

14. Sa takip-silim, nakikita mo ang kagandahan ng mga kalsada dahil sa mga ilaw na nagbibigay ng magandang siluet sa mga tao.

15. He appointed three Supreme Court justices during his presidency, shaping the ideological balance of the court.

16. Instagram has become a platform for influencers and content creators to share their work and build a following.

17. Bahay ho na may dalawang palapag.

18. Anong pangalan niya? Maganda siya ha.

19. May notebook ba sa ibabaw ng baul?

20. All these years, I have been learning and growing as a person.

21. Nasa likod ng aking bahay, natatanaw ko ang bukid na puno ng sariwang mga halaman.

22. Kumaliwa ka papuntang Masaya Street.

23. Inflation kann auch durch politische Instabilität verursacht werden.

24. The President is also the commander-in-chief of the armed forces and has the power to veto or sign legislation

25. Nakita ni Juan ang paparating na bus kaya’t kumaripas siya para maabutan ito.

26. The actress on the red carpet was a beautiful lady in a stunning gown.

27. Transkønnede personer kan opleve diskrimination og stigmatisering på grund af deres kønsidentitet.

28. Nakuha ko ang aking inaasam na sapatos kaya masayang-masaya ako ngayon.

29. If you keep beating around the bush, we'll never get anywhere.

30. Forgiveness is not always easy, and it may require seeking support from trusted friends, family, or even professional counselors.

31. Sa tuwing binabalewala ako ng ibang tao, naglalabas ako ng malalim na himutok sa loob ng aking puso.

32. Kobe Bryant was known for his incredible scoring ability and fierce competitiveness.

33. They may also serve on committees or task forces to delve deeper into specific issues and make informed decisions.

34. Kapag may mga hindi malinaw na plano sa buhay, maaaring magdulot ito ng agam-agam sa mga tao.

35. Nang dumalaw muli ang kanyang ama, pinatawad na niya ito at maging ang kanyang ina ay tuluyang gumaling at napatawad pa rin ang asawa.

36. Itinago ni Luz ang libro sa aparador.

37. Hinampas niya ng hinampas ng kidkiran ang binatilyong apo.

38. The website's social media buttons make it easy for users to share content on their social networks.

39. Upang magawa ito, pinag-aralan niyang makapagsalita ng kanilang wika.

40. Inakalang madaling matatapos ang proyekto, ngunit maraming komplikasyon ang dumating.

41. "Dogs leave paw prints on your heart."

42. Ibinigay ko ang aking panahon at atensyon sa pagtitiis ngayon upang makamit ang magandang kinabukasan.

43. Es difícil saber lo que pasará, así que simplemente digo "que sera, sera."

44. He maintained a contentious relationship with the media, frequently referring to some outlets as "fake news."

45. Mahalagang magkaroon ng budget plan upang maiwasan ang pagkakaroon ng utang.

46. Dadalo si Trina sa workshop sa Oktubre

47. People who give unsolicited advice are a dime a dozen.

48. However, there are also concerns about the impact of technology on society

49. Pwede ba akong pumunta sa banyo?

50. Cryptocurrency is often subject to hacking and cyber attacks.

Recent Searches

manghuliadvancekahilinganhigh-definitionteachersacrificebuntisedsanogensindepinalayaskasuutanwaiterpusabestidabinibilangsumisilipreynaelenalangkayjoblayuansakimcalidadlihimmariloupinagalitanritocollectionsgabingconsistbuwanginangshopeeblazingsalarindalawamapaibabawalexandertradegrinscelularestilladangtiketmayabangsaykasoasthmaaudienceapoypromotingconsumetracklivepublishingidea:transitvedgameeveningrefersproducirtsaabluedemocraticmarsogreenseektools,jacereducedmasdansumamapostcardbagogitanasmakapilingyeahlutuinjunjunitemscontrolledwaitmaratingbetaconditionedit:debatesappstatinginternaobstaclesschoolnothingtelevisedinilingpartnerteamenforcingpdapaga-alalakagalakanhinipan-hipanmagpa-ospitaltinulak-tulakmakauuwinakaluhodnangampanyanagulatpalipat-lipatbabaetumatanglawpinakidalamahinognakatindigyoutube,kaharianmaipagmamalakingpinamalaginabighanikabundukanimpormagsi-skiingsiniyasatsalemagpaliwanagnasasabihannakalipasnagpepekemakangititatlumpungmilyongcountrytuktoknasaannagbentatumatakbotinungocardigangiyeramakapalkaninonangapatdanmasyadongrichpaghaliknalalabingkolehiyopananglawculturasbalediktoryanmauntogmagbalikmagpasalamatsinusuklalyantawaiyongkaraniwangahhhhmaibabalikcitybibigyanginahawlasumasayawnagsisigawsiguropanatagpananakitkababalaghangjolibeeumulangubatnglalabanakangisingumangatnagpasamagovernorspag-unladgoodwaringiyansoundgagwasaklenguajemeronkabuhayansagapbateryaevolvedpaskonglilylimitedofrecenexpresanmakinangcubicledeterminasyonbumili