Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Wenn die Inflation zu schnell ansteigt, kann dies zu einer Wirtschaftskrise führen.

2. Paano daw siya natalo ng isang matanda na mahina na ang mata at uugod-ugod pa.

3. Electric cars can provide a more connected driving experience through the integration of advanced technology such as navigation systems and smartphone apps.

4. Kayo ang may kasalanan kung bakit nagkaganito ang buhok ko!

5. Viruses can spread from person to person through direct contact, airborne transmission, or contaminated surfaces.

6. Gutom ako kasi hindi ako kumain kanina.

7. All these years, I have been striving to be the best version of myself.

8. Naglinis kami ng bahay noong Linggo.

9. Walang puno ang hindi hitik sa bunga.

10. Naging bahagi ang mga kanta ng Bukas Palad sa aking proseso ng pagsasanay sa pagtugtog ng gitara.

11. La esperanza y los sueños son una parte importante de la vida. (Hope and dreams are an important part of life.)

12. Di pa namin napapag-usapan yan 'My.

13. Antioxidant-rich foods, such as berries and leafy greens, can help prevent chronic diseases.

14. Sa gitna ng kagubatan, may matatagpuan kaagad na malalaking punong-kahoy.

15. Ang matandang babae ay pinagpalaluan ng buong barangay dahil sa kanyang karunungan at malasakit.

16. Pito silang magkakapatid.

17. Mathematics can be both challenging and rewarding to learn and apply.

18. Sa mga kasal, kadalasan ay mayroong pagbibigay ng regalo sa mga panauhin bilang pasasalamat sa pagdalo.

19. Nasaan ang Katedral ng Maynila?

20. Nakapagsasakay ang dyipni ng 16 na pasahero.

21. Les personnes âgées ont souvent des problèmes de santé chroniques qui nécessitent une attention particulière.

22. Dahil matamis ang dilaw na mangga.

23. Las heridas superficiales pueden ser tratadas con agua y jabón.

24. She is studying for her exam.

25. Sinimulan ko ng i-collect lahat ng bibilhin.

26. Mathematical concepts, such as fractions and decimals, are used in daily life, such as cooking and shopping.

27. Nakakalasing pala ang wine pag napasobra.

28. Sa palagay ko, pangit ang kotse ng tiyo ko.

29. All these years, I have been discovering who I am and who I want to be.

30. Dahil sa matinding init, marami ang nagiigib ng tubig sa mga puno ng prutas upang hindi ito malanta.

31. Binanggit ko na sa kanila ang aking pagtutol sa kanilang desisyon ngunit hindi nila ako pinakinggan.

32. Kailan at saan ipinanganak si Rene?

33. Nasa likod ng aking bahay, natatanaw ko ang bukid na puno ng sariwang mga halaman.

34. Le chien est très mignon.

35. Hindi ko naiintindihan kung bakit nila gustong gawin ito kaya ako ay tumututol.

36. They are not attending the meeting this afternoon.

37. Ano ang kinakain niya sa tanghalian?

38. Ang guro ko sa heograpiya ay nakatulong sa akin upang maunawaan ang kahalagahan ng mga kalupaan at karagatan.

39. Red horse? Ikaw? nagtatakang tanong ni Genna.

40. Napaangat ako ng tingin sa kanya saka tumango.

41. Sa tapat ng posporo ay may nakita silang halaman na may kakaibang dahon.

42. At leve med en god samvittighed kan hjælpe os med at opbygge stærke og tillidsfulde relationer med andre mennesker.

43. Claro, puedes hacer todas las preguntas que quieras.

44. Kumain ako ng itlog kaninang umaga.

45. Napakahusay nitong artista.

46. Ibinigay ko ang aking panahon at atensyon sa pagtitiis ngayon upang makamit ang magandang kinabukasan.

47. Saan-saan kayo pumunta noong summer?

48. La motivation est un élément clé de la réussite, car elle permet de maintenir un niveau d'engagement élevé dans l'accomplissement d'un objectif.

49. May nakita akong matandang nag-aalok ng pulotgata sa palengke.

50. Cada nacimiento es un milagro y un regalo especial.

Recent Searches

tulangiyakhigh-definitionmabutiampliaanumansumasakayjacky---naglahoboyetasincommunitymaalogumaasamarumiibonipaliwanagpunsonakasuotlorenalcdeveninginfluentialenchanteduponcouldflyclearhatingnag-away-awaybakapagsuboknakasakithapdidekorasyonzoohighestleadeachangkopmerrynasusunognovellesgapmakatulogmilyongtumubomakakatulongparaisosignificantreservesunidoskabilangpagkakakulongexpressionstobaccokumakalansingnapupuntanagtitindamagkaibangnagpuyoshouseholdspansamantalaalapaapnagdiretsomagkakaroonlumisanharapanna-curiousinuulammaawaingtumingaladisensyokasuutanvarietylangkaypapelwinshikingbukaspuwedenatalongfionabingopalagidisyempreisaacpinatidtomarsusunduinatinsamuespadagandasiniyasatstevetipsmapakalibigbobobeyondstandtumulakpahahanapborncomunesduminatutokpinalayaspinapakingganbilibidbinataknowtiniradorsystems-diesel-runonlycommissionbaduylittleedsapalangpaulanakakatabanakuhangredeskumantapagkapanalowikaalikabukinnakakadalawmag-planttogethertumahimikdumagundongmamanhikankumalmatumunogbeautymagpapigillinggongpaglalababowlkuwentomakapagempakegawintelecomunicacionespeksmankadalasmaghilamosnabigaybanalgagamittsonggotablegasmenpagsidlanunosebidensyasupportdiaperexpeditedexperience,nitongdiseaseginawatotoolaylaybatangnaiinggitisasagotplagasaffiliatekendiupuandogsyataosakaprutasomgattractivebiglaiikliaidrambutanmininimizeindustryvirksomheder,dinanasdyipfaultpshguestshangaringinteriorvisginagawaincreasinglypersonsipagpalitbeds