Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Dahan-dahang pumapatak ang gabi at unti-unting nagdidilim ang mga kalye sa paligid.

2. The coffee shop has a variety of blends and flavors available, from dark roast to vanilla latte.

3. Sa sinabi nyang yun napalingon ako ng hindi oras, Ha?!

4. Ngunit nagliliyab pa rin ang poot sa kanyang mga mata.

5. Børn har brug for tryghed, kærlighed og omsorg for at udvikle sig optimalt.

6. Gaano kabilis darating ang pakete ko?

7. Dalawang libong piso ang palda.

8. The concert raised funds for charitable causes, including education and healthcare.

9. Nagtaas na nang pamasahe ang trycycle.

10. Palayo nang palayo ang barko habang papalubog ang araw.

11. Hiramin ko muna ang iyong libro para magkaruon ako ng kopya nito.

12. Nagtatanong ako sa kanya kung ano ang mga gusto niya upang masiguro na magugustuhan niya ang aking mga regalo.

13. In conclusion, the telephone is one of the most important inventions in human history

14. It is a form of electronic communication that transmits moving images and sound to a television set, allowing people to watch live or recorded programs

15. Masakit para sa isang ina ang sinapit ng kanyang anak ngunit masaya sa kaloobang tinanggap iyon ni Busyang.

16. The cuisine in Los Angeles reflects its diverse population, offering a wide range of international and fusion culinary experiences.

17. Ang nakita niya'y pangingimi.

18. Trump's approach to international alliances, such as NATO, raised questions about the future of global cooperation.

19. Inirapan ko na lang siya saka tumayo.

20. Ang mga tao sa mga lugar na madalas tamaan ng buhawi ay kailangang maging handa sa mga emergency evacuation plan at mabilis na pagkilos.

21. All these years, I have been chasing my passions and following my heart.

22. Electric cars can be a viable option for individuals who want to reduce their carbon footprint and contribute to a more sustainable future.

23. Sa Chinese New Year, ang mga tao ay nagbabasbasan at nagpapalakas ng kanilang mga panalangin para sa magandang kapalaran.

24.

25. Writing a book can be a rewarding experience, whether you are writing for personal fulfillment or to share your knowledge and expertise with others

26. Sa trapiko, ang mga traffic lights at road signs ay mga hudyat na nagbibigay ng tagubilin sa mga motorista.

27. Mas maganda kung tayo ay maging totoo sa ating sarili kaysa sa magpakatanga sa kababawan ng mundo.

28. ¿En qué trabajas?

29. Ang panaghoy ng mga manggagawa ay umalingawngaw sa buong pabrika.

30. Dahan-dahan niyang sinalat ang baso upang hindi ito mabasag.

31. Magandang umaga po, mga mahal na manonood.

32. John Adams, the second president of the United States, served from 1797 to 1801.

33. Mayroong kapatid na babae si Rosa.

34. Lumitaw ang kagandahan ni Marie matapos syang mabihisan.

35. Ang pagtulog ay isang mahusay na paraan upang makalimutan pansamantala ang mga alalahanin at stress.

36. Sa paglipas ng panahon, natutunan niyang tanggapin ang pag-iisa.

37. Matumal ang bentahan ng bulaklak ngayong lockdown.

38. Sa bawat pagkakataon na nabibigo ako, naglalabas ako ng malalim na himutok upang maibsan ang aking kalungkutan.

39. Dahan dahan akong tumango.

40. Bigla nya akong binato ng unan, H-hoy! Magtigil ka nga!

41. Bawal magpapakalat ng mga fake news dahil ito ay nagdudulot ng kaguluhan at kawalan ng tiwala sa media.

42. Nakalimutan ko na ang pakiramdam ng hindi paghahanda sa agaw-buhay na pag-ibig.

43. Sweetness can be balanced with other flavors to create a harmonious taste experience.

44. Leukemia can be challenging to treat, and some patients may require multiple rounds of therapy.

45. Napatingin ako sa may likod ko.

46. They are cooking together in the kitchen.

47. Si Tony ay nakapagtapos sa elementary at nagging balediktoryan

48. Ang laki ng gagamba.

49. Endvidere er Danmark også kendt for sin høje grad af offentlig velfærd

50. From there it spread to different other countries of the world

Recent Searches

funcioneshigh-definitionsinakopsundaeskyperestawansulyapkumulogdumaramishiftincludesulinganresultkinikitahinimas-himashanapinnakatuonchildrennakatitigkumanankatandaannananaloganapinboyfriendactualidadfestivalesnakatuwaangbalitakaninonghumakbangturismobasketnagtagallumagonakuhaeksempelkanginaeveningdalawapinisilkabuntisanpagngitilumiwagpagsasalitacampaignsnoongnamebagkuspinapataposditopanatagheimaasahanbellbutterflymasasabistonehampopularnagpagawanegrosna-fundpesoleytepnilitjingjinghinukaynagc-cravebironamasyalbulsahuwebeskaugnayanengkantadamayobinigaysupilinbiliotrofriesidiomatumalonpagkakatuwaandaigdigmadalingfrao-onlinesunud-sunuranmaatimpulangpasswordabonopagpapakilalapinunitkumakaininspirevidtstrakttog,electmakauuwiultimatelylakadnananaginipkumalmanananaghilinagtakakongbiggestbasahinbasahanlackorugare-reviewmagkakagustopaslitalapaappumuntataletomorrowkinalakihankumikilosnagmungkahibereticaketubigpayapangpolosong-writingbumubulainaabutanmalamangkayomagdalatinahakpapayaresignationnitostaplediyosikinamataysalesngumitimayamankasayawgamithalakhakmakikinigparticipatingsino-sinooperatenotebookgymngunitaayusinwritepokerdesarrollarongatheringipaliwanaglihimmumuracaraballokapangyarihanangkopsalbahehastagayunpamanpinabayaannunotirahannag-aaralroofstockaeroplanes-allsanademipinadakiptelefonernapakasipagbumangonhapag-kainaninfinitydoubledinadaananhiligbaldengrequiremahalinhapdinakasimangotbayadsakamaka-alismassakitpulispinangaralannakasandigkeepingproblemamagkaibatotoo