Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Sa takipsilim kami nagsimulang mag-akyat ng bundok.

2. Sa kalayaan, nakakamit natin ang tunay na katarungan at pagkakapantay-pantay.

3. Ang pamilya ang siyang nagbibigay ng kalinga sa bawat isa.

4. Kumaripas si Ana papunta sa terminal para hindi maiwan ng bus.

5. The cake was so light and fluffy; it practically melted in my mouth.

6. La science des matériaux est utilisée dans la fabrication de nombreux produits de la vie quotidienne.

7. They are not cooking together tonight.

8. Hindi ko man masabi sa iyo nang harapan, pero crush kita nang sobra-sobra.

9. Natapos mo na ang proyekto mo? Kung gayon, maaari ka nang magpahinga.

10. Ailments can impact different organs and systems in the body, such as the respiratory system or cardiovascular system.

11. Masamang droga ay iwasan.

12. Lumibot siya sa buong paligid ng ospital upang alamin ang mga pasilidad na maaaring magamit ng kanilang pasyente.

13. Inakalang mahal siya ng kasintahan, pero hindi pala.

14. The website's online store has a great selection of products at affordable prices.

15. Natutuwa ako sa balitang iyan mahal ko.

16. In some cuisines, omelettes are served as a light lunch or dinner with a side salad.

17. The Angkor Wat temple complex in Cambodia is a magnificent wonder of ancient Khmer architecture.

18. He has been gardening for hours.

19. Cars were honking loudly in the middle of rush hour traffic.

20. In 2014, LeBron returned to the Cleveland Cavaliers and delivered the franchise's first-ever NBA championship in 2016, leading them to overcome a 3-1 deficit in the Finals against the Golden State Warriors.

21. The project was behind schedule, and therefore extra resources were allocated.

22. Kung maramot ka sa pagbigay ng tulong, huwag magtaka kung walang tutulong sa'yo.

23. Vivir con una conciencia limpia nos permite dormir mejor por la noche.

24. Nakakain ka ba ng mga pagkaing Pilipino?

25. Dapat magkaroon ng sapat na proteksyon at benepisyo ang mga manggagawa at magsasaka bilang bahagi ng sektor ng anak-pawis.

26. On dit souvent que l'argent ne fait pas le bonheur, mais il y contribue grandement.

27. Ang mga anak-pawis ay nagtatrabaho sa iba't ibang sektor ng ekonomiya, tulad ng agrikultura at pagmimina.

28. They must maintain transparency and communicate with their constituents to build trust and ensure representation is effective.

29. He used his credit to buy a new car but now struggles to make the monthly payments.

30. Ang buhawi ay maaaring magdulot ng pagkalbo sa mga puno, pagbagsak ng mga poste ng kuryente, at iba pang pinsala sa imprastruktura.

31. Dalam Islam, doa yang dilakukan secara berjamaah dapat meningkatkan kebersamaan dan kekuatan jamaah.

32. Les patients peuvent être autorisés à quitter l'hôpital une fois leur état de santé stabilisé.

33. Sweetness can also be found in natural sweeteners, such as honey and maple syrup.

34. The United States has a system of separation of powers, where the legislative, executive, and judicial branches operate independently of one another

35. It's considered bad luck to say "good luck" to an actor, so instead we say "break a leg."

36. Ang aming kasal ay nagpapakita ng pagkakaisa at pagmamahal sa pagitan naming dalawa bilang magkabilang kabiyak.

37. Ang pagpapalinis ng ngipin ay mahalaga para maiwasan ang mga sakit sa bibig.

38. Electric cars are part of a larger movement toward sustainable transportation, which includes public transportation, biking, and walking, to reduce the environmental impacts of transportation.

39. Don't assume someone's personality based on their appearance - you can't judge a book by its cover.

40. Ang kanyang ngiti ay maaliwalas at nakakahawa.

41. Binili ko ang damit para kay Rosa.

42. He used TikTok to raise awareness about a social cause and mobilize support.

43. Si Tony ay nakapagtapos sa elementary at nagging balediktoryan

44. They are running a marathon.

45. Nagsisimula akong mag-exercise sa hatinggabi para sa aking kalusugan.

46. Sa larong sipa, ginagamit din nila ang maliit na bola ng goma.

47. Beauty ito na oh. nakangiting sabi niya.

48. Naghahanap ako ng mga chord ng kanta ng Bukas Palad sa internet.

49. She admires the bravery of activists who fight for social justice.

50. No choice. Aabsent na lang ako.

Recent Searches

advancehigh-definitionkatagaorugacontesteffektivsinunodalexandersoccersabadchangerefersditofakeadditionkabibibroadcastingexistfencingchefenforcingeveningpantallasmagkakaanaknagpakitatatawagmagtiwalakalaroganyanunitedinastatilanakatinginninongtumakbodapatsigabusiness,medievalcryptocurrencyboksingcalleraalislegislativeworldalesalapisamainformedmamanhikannakapagreklamoginugunitanagkakasyasportsaanhinnakatirangguitarrapronountatagalhuertobayadgrocerynag-aabangdreamslihimbateryacreditdatikahilingantradetsaaagilityeksenaclientesfuncionarnothingmakapilingryanwaitliv,nagpalalimkatawangkutsilyokalalaroisasabadhampaslupanasasalinankatutubopangangatawanipipilitroofstocknasaannaliligomakulitligaligpagkaingtinitirhanbinasateacherkuwebagovernmentcocktailreaderscinebotanteprofessionalbernardoouewhybornredgardenhapasinstyrergotriyanpamilyangeskwelahannapatulalamag-ingatnanonoodsay,kalabannatanongpakilagaynapakakasipusanilangexpectationsinfinitynariningpaghakbangmapamazonpagpasensyahanhumayomanghikayatkalayuansurekuwartopinag-aaralanmagtakadiyannabuhayaminggarbansosmalawakenglandtanyagbinibilangbahayopo11pmritobatomarioparanahulisobrabilingdemocraticdidingnatitiyakjunjunerrors,settingleftlabasdigitalconnectingskyldesmumuranagkakatipun-tiponpalipat-lipatguronagliliwanagwalkie-talkienahuhumalingkapangyarihangpamanhikantatayosasamahanpagkatakotpinapataposricapagdudugopagbabayadnakataasmagbalikkargahannatatawasementeryoculpritdealnasunogkauntibumilikalongareglado