Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Nangangamba ako sa pagdidilim ng aking paningin dahil sa pagkakaroon ko ng mataas na grado.

2. Birthday mo. huh? Pano niya nalaman birthday ko?

3. Nous avons renouvelé nos vœux de mariage à notre anniversaire de mariage.

4. While baby fever can be a powerful and overwhelming experience, it is a natural part of the human desire to create and nurture life.

5. La música es una forma de arte que ha evolucionado a lo largo del tiempo.

6. Mahal ko iyong dinggin.

7. Itinaob niya ang kaunting nasahod na balde at ang tubig ay gumapang sa semento at umabog sa kanilang mga paa ni Ogor.

8. Ang poot ang nagbibigay sa akin ng lakas at determinasyon upang harapin ang mga hamon ng buhay.

9. Ang pagsisimula ng malakas na away sa loob ng tahanan ay binulabog ang katahimikan ng pamilya.

10. Yumao na ang lolo ko dahil sa katandaan.

11. Ang paglapastangan sa mga kagamitan at ari-arian ng iba ay isang paglabag sa mga prinsipyong moral.

12. Estoy muy agradecido por tu amistad.

13. The elephant in the room is that the company is losing money, and we need to come up with a solution.

14. Like a diamond in the sky.

15.

16. Saan siya kumakain ng tanghalian?

17. Ang nagdudumaling helicopter ay masigla na naglilipad sa himpapawid.

18. May email address ka ba?

19. Pinaniniwalaang ang albularyo ay may kaalaman sa lihim na karunungan ng kagubatan.

20. Sa tuwa ng Elepante ay kumembut-kembot ito sa pag-indak.

21. Para relajarme, suelo hacer yoga o meditación como pasatiempo.

22. Known for its sunny weather, Los Angeles enjoys a Mediterranean climate throughout the year.

23. Bite the bullet

24. Some viruses, such as herpes and HIV, can remain in the body for life and cause chronic infections.

25. Eine gute Gewissensentscheidung zu treffen, erfordert oft Mut und Entschlossenheit.

26. Climate change is one of the most significant environmental challenges facing the world today.

27. Nagpa-photocopy ng lumang diyaryo

28. Maraming Pinoy ang nagta-trabaho sa ibang bansa bilang OFW.

29. The chest x-ray showed signs of pneumonia in the left lung.

30. Los Angeles is home to several professional sports teams, including the Lakers (NBA) and the Dodgers (MLB).

31. Like a diamond in the sky.

32. Sa takot ng mga tao sa pagsalakay ng mga tulisan, ibinaon nila ang gong sa isang lugar na malapit sa gubat.

33. Nahigitan na nito ang kakayanan ng kanyang ama at ina.

34. Kailangan nating magbigay ng halaga sa mga kababawang bagay upang mag-enjoy sa buhay, pero hindi dapat ito maging priority.

35. The disagreement between them turned out to be a storm in a teacup.

36. Ang pangalan ni Rizal ay itinuturing na sagisag ng pambansang identidad at paglaya sa Pilipinas.

37. Los alimentos ricos en antioxidantes, como las bayas y los vegetales de hoja verde, pueden ayudar a prevenir enfermedades crónicas.

38. Gusto mo ba ng mainit o malamig na kape?

39. Las hojas de los árboles cambian de color en otoño.

40. Biglang lumiwanag ang paligid at si Ipong ay naging hipon.

41. Trump's administration faced scrutiny and investigations, including the impeachment process in 2019 and 2021.

42. Nagbabaga ang damdamin ng bayan matapos ang mainit na balita tungkol sa katiwalian.

43. The project gained momentum after the team received funding.

44. Ano ho ang gusto ninyong orderin?

45. Eating fresh, unprocessed foods can help reduce the risk of heart disease and diabetes.

46. La conciencia nos recuerda nuestros valores y nos ayuda a mantenernos fieles a ellos.

47. The desire for a baby can be accompanied by feelings of emptiness, longing, and a sense of incompleteness.

48. Pwede ba akong pumunta sa banyo?

49. Mayroon ba kayo na mas malaking size?

50. Saan pumunta si Trina sa Abril?

Recent Searches

high-definitiondibaimagessagaptuvodali-dalinapatingalasinampalgranadaitutolshowsorugamansanasreboundlikesbinatangrailwaysabrilsuccessfultingfonoswowlasingerocryptocurrencytoncomienzanparagraphslamesaipinakitaenglishkaninokomedoreveningditopowerobstaclesaalisresultipinagbilingconsidercolourbarinternarecentdenadventannawouldintotaleclientesmuntinlupanaminkagabinangyarisumusunodexistinsteadbinilinguloiginitgitablemarahangkailanmatulisdeliciosamadalingnakangitibiglaansugatfilmsocialenaglutomag-ibananghingilalabhanbestidaapoyatensyonpamantiyapagtangisnagpuntagabingyataipagbilisegundogranmasipagkamalayanpagbahinghulimethodssumunodmaramiplatformsapptagsibolmakaiponnagbentanakikini-kinitapasaherokaniyaitinuturingkwebaofficenakaluhodyariencountertanghaliillegalmakapangyarihanalitaptapnag-bookmesanamtaasmababatidsinapakkasalhapag-kainankumakalansingubos-lakasnagkalapitbisitanakangitingsalbahengnaglalarolarawannatatanawibinilingunitkinsenanlilisikkamaymasayang-masayangmaliitnagsisunodbeginningceshighhalagapreviouslynagtrabahoimagingtomabsgenerateferrereffektivtgabi-gabiuddannelsepagdiriwangaraw-arawbagamatpoliticalnalulungkotnaglalakadgumagalaw-galawisinulatkinagalitanmiyerkolespagpapautangpinagalitankagandahagkinikitamakakasahodlimasawasisentaorderkahaponhinimas-himasinasikasoinaabutannakasandigmahawaankumikinignapakagagandamatapobrengkahulugannakakatandapioneerbumitawdaramdaminnapakamothampaslupanaguguluhanpagtataasmagkaharapnapapikitnaglokohanjingjingculturasmagagamitumiimikvideosintindihinmakapangyarihangnapalitangvillage