Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Cutting corners might save time now, but it will cause problems down the line.

2. Grande married Dalton Gomez, a real estate agent, in May 2021 in a private ceremony.

3. Las drogas pueden alterar el estado de ánimo y la percepción de la realidad.

4. This allows students to take classes from anywhere, and it also allows for the creation of specialized programs and courses that would not be possible in a traditional classroom setting

5. Påsken er en tid, hvor mange mennesker giver til velgørende formål og tænker på andre, der har brug for hjælp.

6. Ginagamit ang "tila" upang ipakita ang pagkakahawig o pagsasalarawan ng isang bagay, sitwasyon, o damdamin na hindi ganap na tiyak ngunit may pagkakahawig sa isang bagay o pangyayari.

7. Sa pangalan ni Apolinario Mabini binuo ang isang award ng Department of Social Welfare and Development para sa mga organisasyong may malaking kontribusyon sa pagtugon sa mga pangangailangan ng mga mahihirap sa lipunan.

8. El agua es el recurso más preciado y debemos conservarlo.

9. Saan niyo ho ba iniisip bumili ng bahay?

10. Medarbejdere skal overholde arbejdstider og deadlines.

11. Workplace culture and values can have a significant impact on job satisfaction and employee retention.

12. Itim ang gusto niyang kulay.

13. Nag-aalalang sambit ng matanda.

14. Nangahas si Pedro na magnegosyo kahit walang sapat na puhunan.

15. El genio de Da Vinci no solo se limitaba al arte, también tenía una mente científica y matemática muy desarrollada.

16. He has been practicing the guitar for three hours.

17. She is learning a new language.

18. Maganda ang website na ginawa ni Michael.

19. Palibhasa ay mahilig mag-aral at magpahusay sa kanyang mga kakayahan.

20. The momentum of the protest grew as more people joined the march.

21. The investment horizon, or the length of time an investor plans to hold an investment, can impact investment decisions.

22. La brisa movía las hojas de los árboles en el parque.

23. Binuksan ko ang pintuan ng condo ko at binuksan ang ilaw.

24. She was worried about the possibility of developing pneumonia after being exposed to someone with the infection.

25. Anong ginawa nya sayo? Sya ba nagpaiyak sayo?

26. Andre helte arbejder hver dag for at gøre en forskel på en mere stille måde.

27. Gusto kong bumili ng bestida.

28. Sa pagguhit, mahalaga ang tamang pagkakabalangkas ng mga elemento.

29. Online surveys or data entry: You can earn money by completing online surveys or doing data entry work

30. Time heals all wounds.

31. Cheating can be caused by various factors, including boredom, lack of intimacy, or a desire for novelty or excitement.

32. Ang paglalabas ng mga pahayag na alam na hindi totoo ay nagpapakita ng pagiging bulag sa katotohanan.

33. Bawal magpaputok ng paputok sa hindi pagkakaroon ng pahintulot ng lokal na pamahalaan.

34. Bless you.. tugon ko sa biglang pagbahing nya.

35. Kumanan kayo po sa Masaya street.

36. Siya ay nangahas na magsabi ng katotohanan kahit alam niyang maaari siyang mapahamak.

37. Football requires a combination of physical and mental skills, including speed, agility, coordination, and strategic thinking.

38. Seperti makan buah simalakama.

39. Noong Southeast Asian Games, nag-uwi si Carlos Yulo ng maraming medalya para sa bansa.

40. Bigla, mula sa tubig ay isang babae ang lumutang sa hangin.

41. Puwede ka ring magguhit ng mga larawan ng kalikasan upang magpakita ng pagmamahal sa ating planeta.

42. Eine hohe Inflation kann zu einem Anstieg der Sozialausgaben führen.

43. Gusto ko sanang bumili ng bahay.

44. Sa mga dagok ni ogor, tila nasasalinan pa siya ng lakas.

45. Ang mga batikang mang-aawit at musikero ay karaniwang itinuturing bilang mga alamat sa larangan ng musika.

46. Mag o-online ako mamayang gabi.

47. Danske møbler er kendt for deres høje kvalitet og eksporteres til mange lande.

48. I am working on a project for work.

49. He has bigger fish to fry

50. Ang aming kaharian ay hindi kayang marating ng taong may katawang lupa.

Recent Searches

kataganoonmatulisuntimelydibahigh-definitionabifeelglobalveryleukemiaipanlinisbataymesangpakelampshreservesmalapadbernardokundilalamunanbungadalinearlycesyearplaysateredyanumiinitbeintebumugascheduleeveningouegalitclockcontrolainteracttutorialsstateroberthapasininvolvesupportallowedryanreturnedinilinghitikhanginmahalineconomickailanpangingimibilinalituntuninthereforekapangyahirancommunicatesparkbituinnaritogodmagbubungamaiingaynapakahusaynailigtaspronounnagsagawaintramurosdecreasednagsulputannatitiraasinmainitnanakawangubatyumuyukoeithertanawinvestipinakotigaspangilsusiparticularnalalabihinigitpropesormaligobansabodamapaibabawmenswarideleadventmadulasbumababainteriortelevisedkumirotjejutumamisestosdrowingberkeleynamuhayevolucionadoearningprinsipesandalingmag-uusapgiveawardaaisshpinagpatiopisinatshirtsaradonepuntanagsmilemagbalikkabutihannakakamittumahanmagbantaysinaliksikmakaangalmahahaliknandayanangangalitinaaminproductividadsumisilipsumingitautomationdeletingrisepelikulaangelaiyakphilippinemalapitanbrasopinagkasundolasamatikmantulalapinamilidollylondongayunpamanmagpa-picturepinakamahalagangkawili-wilikumukuhatherapeuticsamuyintinanggalnagtaposbilibidpaglingonganapinhinanakittaga-ochandonakablueeksempelinilabaspinangaralannakitulogemocionanteteknologimagtataaspagtutoliintayinpagkalitohumahangosnakatapatalikabukinnaglalaronagsasagotkatawangmagsusunuranpapagalitankapangyarihanrevolucionadorenombrepangungutyakinikitapinapakiramdamankumakalansingnaglipananggeologi,namumuongkalalakihan