Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Kanina ka pa? tanong ni Aya sa akin.

2. Sa aming pagtitipon, nagkaroon ng palaro at paligsahan na nagpapakita ng diwa ng bayanihan.

3. Online surveys or data entry: You can earn money by completing online surveys or doing data entry work

4. Les enseignants sont des professionnels de l'éducation qui travaillent dans les écoles.

5. Lumiwanag ang silangan sa pagsikat ng araw.

6. Les algorithmes d'intelligence artificielle peuvent être utilisés pour prédire les tendances du marché et ajuster les stratégies commerciales en conséquence.

7. Ang tubig-ulan ay isang mahalagang bahagi ng siklo ng tubig sa kalikasan.

8. Beauty? tanong pa ni Mrs. Lacsamana.

9. Naniniwala ang ilang tao na ang albularyo ay may kakayahang mag-alis ng masamang espiritu.

10. Hawak ang tirador ay sinaliksik ni Kiko ang buong paligid.

11. Papanhik din sana siya sa tuktok ng burol subalit naabot siya ng rumaragasang tubig-ulan na lalong nagpalalim sa dagat-dagatan.

12. Naglipana ang mga turista sa baybayin ngayong tag-init.

13. Gusto kong manood ng mga pambatang palabas.

14. The lightweight fabric of the dress made it perfect for summer weather.

15. Hindi dapat maapektuhan ng kababawan ng mga tao ang ating mga desisyon sa buhay.

16. The flowers are not blooming yet.

17. Las hojas de mi planta de tomate se ven amarillentas y enfermas.

18. A wedding is a ceremony in which two people are united in marriage.

19. Are you crazy?! Bakit mo ginawa yun?!

20. Ang sakit niya ang nakapanghihina sa kanya.

21. Nagtaas na naman ng presyo ang gasolina.

22. Pakibigay ng pagkain sa mga alagang hayop bago ka umalis ng bahay.

23. Inakalang hindi na darating ang bus, kaya naglakad na lamang sila.

24. Sa facebook kami nagkakilala.

25. The construction of the building required a hefty investment, but it was worth it in the end.

26. Ipanlinis ninyo ng sahig ang walis.

27. Hang in there."

28. Sa brainly ako madalas nakakakuha ng ideya.

29. Napakahusay na doktor ni Jose Rizal.

30. Mi novio me sorprendió con un regalo muy romántico en el Día de los Enamorados.

31. Siya ay nanalangin para sa kaluluwa ng kanyang yumaong kaibigan upang ito'y makalaya na mula sa purgatoryo.

32. Di ko rin alam kung ano na nga bang nangyayari.

33. Facebook has faced controversies regarding privacy concerns, data breaches, and the spread of misinformation on its platform.

34. Galit din sumagot si Amparo "Anong gusto mo alilain ako at busabusin, ako ang masusunod dahil ako ang nakakatanda".

35. Te llamaré esta noche para saber cómo estás, cuídate mucho mientras tanto.

36. Pinasalamatan nya ang kanyang mga naging guro.

37. Madalas na naglalaman ito ng mga konsepto at ideya na mahirap intindihin o masalimuot.

38. Nous avons réservé une salle de réception pour la célébration.

39. Los héroes son modelos a seguir para las generaciones futuras.

40. Ang pagkakaroon ng sariling realidad na hindi nakabatay sa mga katotohanan ay nagpapakita ng pagiging bulag sa katotohanan.

41. La tos puede ser causada por una variedad de factores, incluyendo alergias, infecciones y enfermedades pulmonares.

42. L'intelligence artificielle peut aider à optimiser les processus de production industrielle.

43. Ang pag-asa ay nagbibigay ng lakas sa mga tao upang labanan ang mga hamon sa buhay.

44. He also believed that martial arts should be used for self-defense and not for violence or aggression

45. Ang malakas na tunog ng sirena ay binulabog ang katahimikan ng lungsod.

46. Mabilis na tumatakbo ang kotse papunta sa kaniyang opisina.

47. ¿Qué le puedo regalar a mi novia en el Día de San Valentín?

48. Practice makes perfect.

49. E ano kung maitim? isasagot niya.

50. The acquired assets will be a valuable addition to the company's portfolio.

Recent Searches

high-definitionlipadgeneratepigingkulaycompositoresmatulissumagotmansanashinogpakilutoanitopapayanicoyatabigyanku-kwentapinyuansalagabinghusomeaninggoodeveninginasumakayparosweetwalangsnobcivilizationkalikasansubalityepspareubodintroducerailmajorabenescientistbaulipagbilileyteniyaputisocietyitimyearellenmoreabstainingformapotentialimpitdollarboycleartipidincreasinglyilingentrytermtipactivityenterthoughtsappengkantadataga-nayonnaglakadefficientprogramaeffectmakapilinguloworkshoptig-bebentemateryalesoliviamaingatnanghihinamadapelyidotutoringsasamahaninaaminpagkuwanapasukolaylayakmangpagtatanimmasayang-masayavelstandalas-dosenangahasduwendetulongcommander-in-chiefattentionskypeencuestasdali-dalingtabaschambersagaw-buhaydumibusilakbasketbolkumainkantamartiansakimalapaapnagtitiisbiocombustiblespotaenaguitarramakikiraanmagkakailamagpa-checkupkinamumuhianmakakawawahila-agawannasasakupannagpatuloynag-iinomalikabukinmangangahoymakapallawamonsignorpinabayaannaghubadhistorypandidirinakauwidadalolayuannapaano-anobuwalhikingcarriessumisidtiyanubosikobumigaybumabagnotebookfull-timerailwaysmaestrobio-gas-developingadicionalessandokdesdeakofeltfatnagginghatingnakangisiyonratelorenaincludelasinggoingminutenagawanamumukod-tangimagkakagustonakaliliyongmedya-agwaisasabaduusapannawalangpahahanappagmamanehomagazinespupuntahanpagdudugonananalongpaglakinauliniganbusiness:malapalasyokaratulanguniversitysinaliksiklazadapaninigasdi-kawasainspirationhawaiitinikmangasmenkargahanminerviepoint