Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Marahil ay magpapasko na kaya't maraming tao ang nagpaplanong bumili ng mga regalo.

2. He is typing on his computer.

3. Hindi ko alam kung may chance ako, pero ito na - pwede ba kita ligawan?

4. Nasa labas ka ba? Teka puntahan kita dyan.

5. Påsken er også en tid, hvor mange familier samles og fejrer sammen.

6. Pinaghihiwa ko ang mga kamatis.

7. They have sold their house.

8. Ang tubig-ulan ay maaaring magdulot ng pagkakasakit kung hindi magiging maingat sa pag-inom nito.

9. Nakinig ang mga estudyante sa guro.

10. Habang naglalakad siya, nakita ko siyang tulala sa kanyang cellphone.

11. Bagai pinang dibelah dua.

12. Beast... sabi ko sa paos na boses.

13. Sa kasalukuyan, yumabong ang interes ng mga tao sa pagsasaka ng mga organic na gulay.

14. Ang droga ay hindi solusyon sa mga suliranin ng buhay, kundi dagdag pa itong suliranin.

15. Dadalo si Trina sa workshop sa Oktubre

16. Ang saranggola ay simbolo ng kasiyahan noong kabataan.

17. This has led to increased trade and commerce, as well as greater mobility for individuals

18. This has led to increased trade and commerce, as well as greater mobility for individuals

19. Elle aime beaucoup écouter de la musique classique.

20. Ang bawat mabangong lasa sa kusina ay nagpapahiwatig ng isang masarap na handa.

21. Limitations can be challenging, but they can also inspire creativity and innovation.

22. Maraming bansa ang nagkakaisa upang magbigay ng tulong sa mga bansang naapektuhan ng digmaan.

23. How I wonder what you are.

24. Pagkatapos maligo, ang katawan ay nagiging mabango at malinis sa amoy.

25. Hawak niya yung kamay ni Gelai habang palapit sa amin.

26. Hinanap nito si Bereti noon din.

27. La esperanza es lo que nos mantiene adelante en momentos difíciles. (Hope is what keeps us going in difficult times.)

28. Su estilo artístico se caracterizaba por la tensión emocional y la expresión dramática.

29. Bigla nya akong hinigit sa kwelyo, Anong sinabi mo?

30. Hinde naman ako galit eh.

31. The United States is a culturally diverse country, with a mix of ethnicities, languages, and religions.

32. Saan pupunta si Larry sa Linggo?

33. Electric cars are quieter than gasoline-powered cars due to the absence of an internal combustion engine.

34. Ano ang pangalan mo? ang tanong niya sa bata.

35. Kailangan ko ng pliers, puwede ko bang hiramin ang iyong tools?

36. His administration pursued a more confrontational stance towards countries like China and Iran.

37. Ang malakas na pagkokak ng mga Palaka at paghuni ng mga Kuliglig ay sumaliw sa awit ng mga Maya.

38. Players move the ball by kicking it and passing it to teammates.

39. Ang mga indibidwal na may marahas na asal ay maaaring humantong sa pagkakasangkot sa legal na problema.

40. "Dogs are not our whole life, but they make our lives whole."

41. Investors with a lower risk tolerance may prefer more conservative investments with lower returns but less risk.

42. At noon, higit kailanman, naging hamak sila sa pagtingin ng lahat.

43. Naglakad ang mga sundalo sa kalsada nang limahan.

44. However, excessive caffeine consumption can cause anxiety, insomnia, and other negative side effects.

45. Wolverine has retractable adamantium claws and a regenerative healing factor.

46. The stock market can be used as a tool for generating wealth and creating long-term financial security.

47. Ang buhay ay parang gulong, minsan nasa ibabaw, minsan nasa ilalim.

48. Hindi ko mapakali ang aking sarili dahil sa aking mga agam-agam tungkol sa aming kasal.

49. My sister gave me a thoughtful birthday card.

50. La labradora de mi tía es muy inteligente y puede hacer trucos increíbles.

Recent Searches

nakahigh-definitionmalamangsagapnatalonginangsoundinihandakarapatannakasuotalexanderganasuccesssangpabalangdiscoverednunoattractivebinatangpriestritobossvocalpakelamomelettefuesweetoruganaghinalabuslomestiikutanmesanayonaudio-visuallyiconrosedatapwathallknowsmeettalentedfakewordslabornakabaonalltaun-taonselebrasyonmasyadoheilorenaincreasinglyfacilitatingeveningfinishedliveinisagosdaangfallrecentmereeitherbabe1982dadhatingrolledplatformsagekwenta-kwentaeksperimenteringmalusogpinagpapaalalahananmunamananahimakakuhat-shirtkahuluganbawianstudiedwaldopangtagpiangnakabluepinaghalobihirab-bakitsakopinilagay3hrsngipingnagpapasasakailanpinalayaspiecesreleasedumaagoslayawmatikmansarilinakamitpinapakiramdamankaninumantagalpauwikasalanannagpalutomatakotbayaningpagbebentajuiceprintpanunuksongunitnaguusaptienensapaskillspahiramalasspeechesjuannagtatampopowersrefnegro-slavesstartedulingnagkitamurang-muramakalaglag-pantyprivatekumaliwaneedlessnanahimikalas-diyesmumuramakakawawakapangyarihangmalezamahahalikkumikilosinjurynagpagupitmakakakaendadalawininaabutannapatayomelvinloob-loobmakikitulognakatindignakapasanagkasakitnovellesnamataykatuwaanmananakawsay,americamadungismagkasakitmagtakawatawatmahinavillagelumipadnagsamanagsilapitginawaranmahirapkumampitennisusuariokurakottalinosubject,padalasnagyayangmahaboliligtasbinentahansinobinuksanfilmsawang-awarimastmicacreceraayusinmatutulognobodyexigentelalargalayuanagilapokercity