Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. By refusing to compromise, she ended up burning bridges with her business partner.

2. Einstein's brain was preserved after his death and has been studied by scientists to try to understand the neural basis of his exceptional intelligence.

3. Ailments can impact different organs and systems in the body, such as the respiratory system or cardiovascular system.

4. Aku sangat sayang dengan kakek dan nenekku. (I deeply love my grandparents.)

5. Sueño con tener la libertad financiera para hacer lo que quiero en la vida. (I dream of having financial freedom to do what I want in life.)

6. Nasi padang adalah hidangan khas Sumatera Barat yang terdiri dari nasi putih dengan lauk yang bervariasi.

7. Huwag magpabaya sa pag-save at pag-invest ng pera para sa kinabukasan.

8. Wala na siguro sya, baka natulog na inantok na.

9. You reap what you sow.

10. Mi temperatura es alta. (My temperature is high.)

11. Nous avons prévu une séance photo avec nos témoins après la cérémonie.

12. Inisip niya kung ano ang kasuutan nito na maaari niyang pagkakilanlan, ang tabas ng mukha, ang gupit, ang tindig.

13. Sinuspinde ng pulisya ang operasyon sa paghuli ng salarin dahil sa kakulangan ng ebidensiya.

14. Trump's handling of the COVID-19 pandemic drew both praise and criticism, with policies like Operation Warp Speed aiming to accelerate vaccine development.

15. I don't eat fast food often, but once in a blue moon, I'll treat myself to a burger and fries.

16. Sa takipsilim kami nagsimulang mag-akyat ng bundok.

17. Ang laki ng kalabaw ni Mang Jose.

18. The novel might not have an appealing cover, but you can't judge a book by its cover - it could be a great read.

19. Il est important de connaître ses limites et de chercher de l'aide si l'on rencontre des problèmes liés au jeu.

20. Ang banal na kumbento ang naging tahanan ng mga sakristan.

21. Maganda ang kulay ng langit sa dapit-hapon.

22. Kumusta? Ako si Pedro Santos.

23. Ang taong nagigipit, sa patalim kumakapit.

24. Nagtatampo na ako sa iyo.

25. Ang mga biktima ng paggamit ng droga ay dapat bigyan ng tulong upang maibalik ang kanilang kalusugan at makabalik sa normal na buhay.

26. Wag kang magtatanim ng sama ng loob sa kapwa.

27. I don't want to cut corners on this project - let's do it right the first time.

28. Napangiti siyang muli.

29. Ikinuwento niya ang nangyari kay Aling Pising.

30. Kebahagiaan juga dapat ditemukan dalam pengembangan diri, seperti belajar hal baru atau mengejar hobi yang disukai.

31. The restaurant bill came out to a hefty sum.

32. Ang laki ng sawa na kanyang nakita.

33. Gayunman, si Cupid ang nabighani sa kagandahan ni Psyche.

34. Ang mga eksperto sa kalusugan ay nagbahagi ng kanilang mga mungkahi upang mapabuti ang mga programa sa pangangalaga sa kalusugan.

35. The Great Wall of China is an impressive wonder of engineering and history.

36. Ang tarangkahan ng aming tahanan ay kulay pula.

37. Magmula noon nakilala na sa Palawan ang pating.

38. Hinimas-himas niya yung likod ko pagkalapit niya saken.

39. Nangangaral na naman.

40. Oh gosh. Inintay pa sya ng prince, what does it mean?

41. The widespread use of digital devices has led to an increase in sedentary behavior and a decrease in physical activity

42. Marami silang pananim.

43. International cooperation is necessary for addressing global environmental challenges, such as climate change.

44. En algunas regiones, el invierno puede ser muy frío y peligroso para la salud si no se toman las precauciones adecuadas.

45. Overcoming challenges requires dedication, resilience, and a never-give-up attitude.

46. Some people take April Fool's really seriously, planning elaborate pranks and hoaxes for weeks in advance.

47. Hinawakan ko yung tiyan ko, Konting tiis na lang..

48. Bless you.. tugon ko sa biglang pagbahing nya.

49. Sa tuwing nakikita kita, nadarama ko na may gusto ako sa iyo.

50. Tara na. binuksan ko yung pinyuan tapos lumabas kami.

Recent Searches

haringhigh-definitionkamaoscarkalabawlumahoknawalasapatosincluirkaminakalagayemphasishumiwatransportmidlerpaghaliknagngangalangmateryalesbeenpagtitindadeliciosanatigilanchoosetrinausopackagingkartonkayanagmamaktoltrainsnami-misskaswapanganvehiclespakistangayunmanmangyayarirobertlangmagbubukidpananimkasamaangpakiramdamstaymagkasintahanapologeticmaipapautanglimanganiinantayilanninongpagtayopatpatmaliligokabarkadanagkantahaneducatingellenbahanadamapatuloynakatalungkomakitaasawanyangagadtraffictanghaliunidosiyamotipinagbabawalmaduronapatulalakinagatbinyagangbisikletamakagawas-sorrytaleskillnakumagselosnag-uumiritumigiltilib-bakitpongwalaginangtrajemanghikayatmukhangtsupermahiligalongkamakalawasigeneronawawalanahahalinhanmananaloatensyonitinagonasusunogrelativelylulusogpositionertangomakapaghilamosmacadamiatitsersuzettepinangyarihanpalamutisarilinglearningambagmaniwaladurimemorialstudentsnag-iisangmakeskakayurinlutoproducirkaylungsodnamataylumusobmananaogsyncthirdwriting,peer-to-peermagpa-checkuppagbahingdinaladesarrollarauthorsandalibranchcubiclepointparadesisyonandiliginlumuwassaritaalingseriousnagtagisannakalilipasnananaghilininyongsumabogsumigawtinurosourcepdacassandracontinuedipinatutupad00amstorytelebisyonestudioharaputilizarstructureginoongsiyacanteenpunongkahoynangyarihinigitacademynaglakadnaglulutosulinganrepublicinsteadmahalagareynaniyanintsikkumakainadaptabilitytaga-hiroshimasinwastepresidentbaromatatalimalbularyodisenyosusunodrepresentativeshumalakhaknaglalabaculturas