Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Hendes interesse for kunst er fascinerende at se på. (Her interest in art is fascinating to watch.)

2. Anong hindi? Eh pulang-pula ka na oh!

3. Sweetness is a sensation associated with the taste of sugar and other natural and artificial sweeteners.

4. Work can also provide opportunities for personal and professional growth.

5. Mahal na mahal ng ama't ina si Ranay.

6. Where there's smoke, there's fire.

7. Les personnes âgées peuvent avoir besoin de soins médicaux réguliers pour maintenir leur santé.

8. Doa dapat dilakukan kapan saja dan di mana saja, tidak harus di tempat ibadah.

9. Have you been to the new restaurant in town?

10. Grande married Dalton Gomez, a real estate agent, in May 2021 in a private ceremony.

11. Viruses are small, infectious agents that can infect cells and cause diseases.

12. All these years, I have been creating memories that will last a lifetime.

13. Mataman niyang inisip kung may iba pang nakakita sa nangyari.

14. Madali ka nitong bibigyan ng paninda kung may sarili kang bangkang paghahanguan ng mga huling isda sa karagatan.

15. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

16. Gusto ko na umuwi ng Pilipinas.

17. Ang ganda pala sa enchanted kingdom!

18.

19. Ang koponan nila ay mas handa at mas determinado, samakatuwid, sila ang nagwagi sa paligsahan.

20. Maraming taon na ang nakaraan, may isang munting baranggay sa paanan ng isang bundok.

21. Sana ay masilip.

22. Tinikman nila ang hinog na bunga at natuwa sa tamis at sarap nito.

23. Mauupo na lamang siya sa kanyang balde.

24. Gaano kalaki ho ang gusto niyo?

25. I set my alarm for 5am every day because I truly believe the early bird gets the worm.

26. A lot of laughter and joy filled the room during the family reunion.

27. Makaka sahod na siya.

28. Las drogas pueden alterar el estado de ánimo y la percepción de la realidad.

29. Eine hohe Inflation kann die Investitionen in die Wirtschaft verlangsamen oder sogar stoppen.

30. Napatingin ako sa orasan. 12 na ng madaling araw.

31. Amazon offers a wide range of products and services, including electronics, clothing, books, music, and more.

32. The Great Barrier Reef in Australia is a wonder of marine life and coral formations.

33. Lazada's influence on the e-commerce industry in Southeast Asia is significant, and it is likely to continue to be a major player in the years to come.

34. Ah miss, tanong lang... Iyo bang lahat yan?

35. Pagdating namin dun eh walang tao.

36. La comida tailandesa es famosa por su sabor picante.

37. Ang awitin ng makata ay puno ng hinagpis na naglalarawan ng kanyang pagkabigo sa pag-ibig.

38. Pinatawad din naman ni Ana ang mga ito.

39. It's hard to enjoy a horror movie once you've learned how they make the special effects - ignorance is bliss when it comes to movie magic.

40. Dogs can be trained for a variety of tasks, such as therapy and service animals.

41. Sang-ayon ako na ang edukasyon ay isang mahalagang pundasyon sa pag-unlad ng isang bansa.

42. Kumaripas ng takbo ang kabayo nang bumitaw ang sakay nitong tao.

43. The river flows into the ocean.

44. ¿Te gusta la comida picante o prefieres algo más suave?

45. A father's love and affection can have a significant impact on a child's emotional development and well-being.

46. Nag shopping kahapon si Tita sa SM.

47. Eksport af elektronik og computere fra Danmark er en vigtig del af landets teknologisektor.

48. Si Datu Duri ay matandang-matanda na.

49. Holy Week is observed by Christians around the world, with various traditions and customs associated with each day.

50. Kailangan nating magbasa araw-araw.

Recent Searches

high-definitionmanghulipaksakaraniwangpataybalakfuelparimaaripopularizesumayabaulmoodwowheardilimlenguajeviewsobstacleschefbadpasokknowssaringcoattodaydolyarsourcerepresentativevisualactorremotehelplumalaonstrategysummitcharitablewhyconstitutionechaveipagtimplapermitenaramdamanparkbefolkningennaiinitanmaramdamanmatandaprosperdiednagmistulangagam-agamsopasmatarikmaliittuwangkinagagalak1920smasayapagsubokalwayseksamvasquesipinagbilingtransittextopromotingcuandooftenbetadoonworkdayblazingattentioniniinomadangpriestkasingtigasnagalitchavitbilhinsubjectvampiresdollyyelocover,taospundidokuripottinungomagkanoressourcernenakapapasongnagsisipag-uwianmagpapigilmakawalaengkantadangmagpagupitmalulungkotmaabotflyvemaskinerkinikilalangmasayahinnagandahannanghihinanangyarimaipagmamalakingmaliwanagtinutopnakapasoknaibibigayconsideredreorganizingtumindignakauslingpwestonabigyancombatirlas,marketingonline,manirahanpoongaksiyonlansangankaraokemetodiskgusaliginoongumokaymatutongbrasoninyotagaroondomingoreynakendiadmiredpakaininomfattendeasawanatayosahoddogskulayinatakemataraykarangalansagapstocksmaaaritarcilanai-dialapoyconsumebilibartiststapossaansilbingmagdacanadailangi-markhumanolorisoonpicstools,comekararatingiconkumarimotbaleself-defenselamesaumarawlinahinihintaymagbibigaymagbibiyahengumiwiamerikagalaannalungkotlumalangoytononahihirapankwenta-kwentatinahakdeveloppaboritogumagalaw-galawjaceenvironmentservicesdreamsnagpaiyakprocessesjuanalaamang