Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Tangka na niyang pagbubuhatan ng kamay ang matanda nang biglang lumiwag ang damit ng matanda at nagbago ang kanyang anyo.

2. Sana ay makapasa ako sa board exam.

3. Healthcare providers and hospitals are continually working to improve the hospitalization experience for patients, including enhancing communication, reducing wait times, and increasing patient comfort and satisfaction.

4. Lazada has faced criticism over counterfeit products being sold on its platform.

5. Kumikinig ang kanyang katawan.

6. Investing requires discipline, patience, and a long-term perspective, and can be a powerful tool for achieving financial goals over time.

7. The weather today is absolutely perfect for a picnic.

8. Tobacco was first discovered in America

9. Paano mo nalaman? tanong ko sa kanya.

10. Her music career took off with her debut album Yours Truly in 2013, featuring the hit single "The Way."

11. Napuno ako ng poot nang malaman ko ang mga kasinungalingan na ibinato sa akin.

12. Nagbigayan kami ng mga regalo noong Pasko.

13. Nakipagtagisan sya ng talino sa kapwa estudyante.

14. Nagpakitang-gilas si Jose sa pamamagitan ng mabilis na pagpasa ng bola.

15. Ang pagkakaroon ng malalakas na ingay mula sa kapitbahay ay binulabog ang kapayapaan ng tahanan.

16. Las escuelas tienen diferentes especializaciones, como arte, música, deportes y ciencias.

17. I am absolutely confident in my ability to succeed.

18.

19. Mathematics can be both challenging and rewarding to learn and apply.

20. Sama ako. inulit nya lang ang sinabi nya.

21. Bilang isang Kristiyano, nagbibigay ng kahalagahan sa aking buhay ang mga awiting Bukas Palad.

22. Her perfume line, including fragrances like "Cloud" and "Thank U, Next," has been highly successful.

23. Ang kalayaan ay nagbibigay sa atin ng kakayahang magpasya at magplano para sa ating sariling kinabukasan.

24. Ano ang pinapakinggan mo sa radyo?

25. The authorities were stumped as to who the culprit could be in the unsolved case.

26. Gracias por iluminar mi vida con tu presencia.

27. Mukha namang pangkaraniwan lang ang matanda at baka nga hindi pa nito alam kung paano humabi.

28. Der er forskellige organisationer og grupper, der tilbyder støtte og ressourcer til transkønnede personer og deres familier.

29. Sa pag-aaral ng mga palaisipan, mahalagang maging mapanuri at malikhain upang malutas ang suliranin.

30. Upang huwag nang lumaki ang gulo ay tumahimik na lang si Busyang, nagpatuloy naman sa pakikipagtagpo sa mayamang Don Segundo ang ambisyosang anak.

31. Gamit niya ang kanyang laptop sa proyekto.

32. Sa kulturang Pilipino, ang punong-kahoy ay kinikilala bilang simbolo ng kalikasan at pagiging matatag.

33. Attractive packaging and expert publicity helped spread the addiction to smoking cigarettes even among the poorer sections of the people

34. Cheap sunglasses like these are a dime a dozen.

35. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

36. Waring nag-aalinlangan siyang sagutin ang tanong ng guro.

37. Ang paglapastangan sa mga batas at regulasyon ay nagdudulot ng kawalan ng disiplina sa lipunan.

38. Biglang naalaala ni Aling Rosa ang huli niyang sinabi kay Pina, na sana'y magkaroon ito ng maraming mata para makita ang kanyang hinahanap.

39. Nakita niya ata ako kaya tinigil niya yung pagsasalita niya.

40. Tanging edukasyon lamang ang pag-asa nating mahihirap.

41. Las escuelas también ofrecen programas de apoyo, como tutorías y asesoramiento académico.

42. Muli ay nakabawi ang ekonomiya ng Pilipinas matapos buksan ang turismo sa iba't ibang panig ng bansa.

43. El algodón es un cultivo importante en muchos países africanos.

44. Baket? nagtatakang tanong niya.

45. Ang itim mo, Impen! itutukso nito.

46. Nakakatulong ang malawak na bintana sa silid-aralan upang pumasok ang natural na liwanag sa loob ng silid.

47. Nakahug lang siya sa akin, I can feel him..

48. Pulau Bali memiliki banyak tempat wisata terkenal lainnya, seperti Ubud yang terkenal dengan seni dan budayanya serta tempat surfing seperti Uluwatu dan Padang-Padang.

49. Sa kasalukuyang panahon ang bayabas, bukod sa ito ay kinakain o pagkapitas sa puno, ito rin ay ipinansasahog sa ating mga lutuin.

50. The model on the runway was a beautiful lady who effortlessly commanded attention.

Recent Searches

kananhigh-definitionnoonkatagatalepalitanbiyernessearchminutoindiahousealexanderreboundipantaloppumatolsuotmadurassawabinilhankamisetangkamag-anakcanteenkakayanangipinabalikoncemeetmurangavailabledagafakewidespreadadditionroomgisingpakelamseenjuniomarkedmetodestageyangauthoreveningmainitbruceballwritedesdeconvertingadaptabilityrequirecableshouldcountlessmaratinggoingnotebooksecarseitlogsellcarbongamesnatalongtungkolincidencekamakalawanangyarirockmariabyerealisticsinulidtumikimmagdaraospamilyanandoonsinabifulfillingkauripinagalitantitakaratulangmakabilistarsfreelancerlongintsik-behokapitbahaytoyahitiyantalinokitahhhhbuung-buopakukuluansetyembrehumayonatulakmagsusunuranbeautytaga-hiroshimadiaperpesostillnamasyalbilangguanburgershockscalesiyatinigkinasisindakanguitarrapansamantalamananakawmalapalasyomakikiligopagmamanehouugud-ugodundeniablekanayangnamilipitnuevosniyogpasahe1970smangingisdangmaibasumakitplacecontestreachattentionpresyobingomaulitpagkalungkotmagkikitapalipat-lipatdadalawinmakasilongmagpagalingpamamasyalunti-untinamulatnegosyantepagkakalutonaglakadtumatakbonaglokohanlumutangalapaapsabihinnapatigilmakikitulognaabotpaki-ulittinanggaltradisyonnasilawnabuhaypinangalanancompaniespagdamilangkaymaibabalikgjortmoneylugawiniangattransportipagtanggoldisseedsasundaebateryalilynanaymatabanglaruanmamalaspriestkasomukaexhaustedzoolanddibaitayaraymag-aralpangulolaterpowernagreplyproverailroboticoras