Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Ang aming kaharian ay hindi kayang marating ng taong may katawang lupa.

2. He has been practicing yoga for years.

3. En boca cerrada no entran moscas.

4. Gaano katagal ako maghihintay sa bus?

5. Hindi dapat nating kalimutan ang ating mga pangarap kahit na nagbabago na ang ating mga prioridad sa buhay.

6. Kumain sa canteen ang mga estudyante.

7. Kailangan ko ng Internet connection.

8. You reap what you sow.

9. Hindi na nakita ni Aling Rosa si Pinang.

10. Kahit malilimutin si Mia, sinisikap niyang ayusin ang kanyang schedule para maging maayos ang kanyang araw.

11. Habang nag-oorasyon nagising si Mang Kandoy dahil sa mga bulong ng salamangkera.

12. The backpack was so hefty, it felt like it weighed a ton.

13. El proceso de dar a luz requiere fortaleza y valentía por parte de la madre.

14. Parating na rin yun. Bayaan mo siya may susi naman yun eh.

15. Tila nag-aalinlangan siyang sagutin ang tanong ng guro.

16. Tuluyan na siyang pumasok ng kwarto at isinara yung pinto.

17. Anong kubyertos ang hiningi ni Maria?

18. Makakasahod na rin ako, sabi niya sa sarili.

19. Format your book: Once your book is finalized, it's time to format it for publication

20. Inakalang madaling matatapos ang proyekto, ngunit maraming komplikasyon ang dumating.

21. The Angkor Wat temple complex in Cambodia is a magnificent wonder of ancient Khmer architecture.

22. Ang pagtugtog ng malamig na musika ay nakatulong sa akin na magrelaks at magkaroon ng matiwasay na isip.

23. Pahiram ng iyong mga notepads at ballpen para sa aking meeting.

24. Sa pagtatapos ng araw, nakakapagbigay ng kakaibang kalma ang pakikinig sa musika habang nag-iisa.

25. Natutunan ko ang mga awiting Bukas Palad mula sa aking mga magulang na parehong Katoliko.

26. Ayaw kong pag-isipan ang sinabi mo.

27. Limitations can be physical, mental, emotional, financial, or social.

28. Umalis siya upang hanapin ang sandok na hinahanap.

29. He has written a novel.

30. Ayon sa mga ulat, may paparating umano na bagyo sa susunod na linggo.

31. Ang suporta ng pamilya ni Carlos Yulo ang naging pundasyon ng kanyang tagumpay.

32. The decision to release the product early was a risky but ultimately successful strategy.

33. Sa harap ng libingan, naghihinagpis ang mga kaibigan at pamilya ng namayapang kaibigan.

34. Matagal na yan. Hinde ko lang nabigay sayo.

35. Te agradezco por estar siempre ahí para mí.

36. Eto namang si Kuya di na mabiro! Bagay na bagay kaya kayo!

37. Leonardo da Vinci trabajó para los Médici en Florencia.

38. Sa tuwing pinagmamalupitan ako, lumalalim ang poot at humahantong sa galit.

39. Nasa akin pa rin ang huling halakhak.

40. Lumapit ang mga tao kay Ana at humingi ng tawad sa kaniya sa pagiging marahas ng mga ito.

41. Ang pagtanggap ng tubig-ulan ay isa sa mga pamamaraan ng pagtitipid ng tubig sa panahon ng tagtuyot.

42. Mahal ang mga bilihin sa Japan.

43. Sa pagsalubong ng Bagong Taon, ang langit ay hitik sa mga kulay sa pamamagitan ng mga paputok at mga fireworks display.

44. Naging kaibigan ko muna ang aking nililigawan bago ko siya niligawan upang mas makilala ko siya nang husto.

45. Si Josefa ay maraming alagang pusa.

46. Nagsisilbi siya bilang guro upang ituro sa kanyang mga estudyante ang tamang edukasyon.

47. Sa wakas, aalis na si Ogor, naisip niya.

48. Después de la lluvia, el sol sale y el cielo se ve más claro.

49. Cut to the chase

50. Kasi ho, maraming dapat kumpunihin sa bahay.

Recent Searches

high-definitionedit:differentmanghuligenerabaleftnababalotsipalabing-siyambeginningnagkakatipun-tiponkaugnayanbinawitandainirapangagawinrawamendmentssutilmesakaylumibotgeneratedexplainadditionmakingmagdadapit-hapongitaranapapikitbumahakastilapinagalitanfitnesspinangyarihanparketabascongressmayorsingaporepinauupahangpinakatuktokbigyanjohnmadalaspinaghihiwapapagalitanpinaghandaansubalitpinagsasasabitransport,pinapanoodkategori,gayunpamanmovieshisbook,mensajesjapanpagkokaklololot,filmskikitakanayangbaranggaynakikitangtuloy-tuloykayopinaggagagawafilipinadyosajagiyapinagpatuloynicopagkagalitseryosonghomesnakikiaobra-maestrapanalanginyouthspanslifepapasasupilinniyanmangahaseskuwelananlilisiklandaskanluranamerikamoodbahaysuhestiyonattorneyprimerossabimultokitangmusicpinakamahalagangnagdadasalmabatongpresidenttelangnuhnoolumulusobnataloamericantelecomunicacioneslaptopempresasagwadorsisikatnakalipasposternagugutomgandabituinpinanoodeducationalpinangalanansapagkatmagbabalaganunkuwebapinag-usapanracialturomatchingnaguguluhannagsmilemagkaibabyggethinihintaysagotlabishinimas-himaskinakailangangnakapasasetpiecesdibisyonsinimulankayabanganinanasagutanmag-ibanakakapasoknaulinigantinapayanghelmagpapalitnag-oorasyonpartymaalwangdiseasesninyogenepinanakalagaypagtawaikinakagalitbagkusobservation,itotaga-ochandonagpakitayoutubenamepagbabagobehalfkinatatalungkuangmajorkayang-kayangsinamasayasorryiconcarrieshinampaskasimaipagpatuloyevnegoalkaparusahanselebrasyonmakalaglag-pantykuryentedispositivokinauupuannangagsipagkantahantigasganidmagbungapelikulapnilitbag