Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Nagbakasyon si Clara sa Hawaii.

2. The surface of the football field can vary, but it is typically made of grass or artificial turf.

3. To break the ice at a party, I like to start a game or activity that everyone can participate in.

4. Napaiyak ako dahil sa pelikula.

5. Aling telebisyon ang nasa kusina?

6. Kung alam ko lang na ganito kasakit ang magiging parusa ko

7. Doa dapat dilakukan dalam bahasa apapun, asalkan dipahami oleh orang yang melakukan doa.

8. Kumain kana ba?

9. En invierno, los árboles pierden sus hojas y se vuelven caducos.

10. Bwisit talaga ang taong yun.

11. I absolutely agree with your point of view.

12. Hinagud-hagod niya ang mga kamao.

13. The children are not playing outside.

14. Sa loob ng sinehan, nabigla siya sa biglang pagsabog ng surround sound system.

15. Ang mga palaisipan ay hindi lamang nagbibigay ng hamon sa ating kaisipan, kundi nagbibigay rin ng mga oportunidad para sa pagpapalawak ng kaalaman.

16. The guilty verdict was handed down to the culprit in the embezzlement trial.

17. Pagkababa, mabilis na siyang nagyayang umuwi.

18. Ang lahat ng taong napapadaan sa nasabing puno'y napapahinto dahil sa dami ng bungang nakasabit sa mga sanga.

19. "Ang batang matalino, may alam sa lahat ng bagay" ay isang bukambibig na nagpapahayag ng husay at talino ng isang batang may malawak na kaalaman.

20. Women have been celebrated for their contributions to culture, such as through literature, music, and art.

21. Ikaw nga ang dumukot ng pitaka ko at wala nang iba.

22. Tumayo na sya, Ok! I'll be going now, see you tomorrow!

23. Der er også mange forskellige former for motion, som kan udføres uden nogen speciel udstyr, såsom gåture og trappetrin træning.

24. Ang maliit na mesa ang nasa kuwarto.

25. Ginagamit ang salitang "umano" upang ipahiwatig na ang isang pahayag ay hindi pa tiyak at batay lamang sa sinasabing impormasyon mula sa ibang tao o ulat

26. Magkano po sa inyo ang yelo?

27. Magkaiba ang ugali nila, si Amparo ay tamad at walang kinagigiliwang gawin kundi ang lumapit sa mga bulaklak at amuyin ito.

28. Hindi ko man masabi sa iyo nang harapan, pero crush kita nang sobra-sobra.

29. Bumibili si Erlinda ng palda.

30. Ang talambuhay ni Manuel L. Quezon ay nagpapakita ng kanyang pagmamahal sa bayan at liderato sa panahon ng kolonyalismo.

31. Ano ang ginawa ni Trina noong Pebrero?

32. Kung hindi naman ninyo kaya ay sabihin ninyo at tatawag ako ng ibang pulis.

33. Sebelum kelahiran, calon ibu sering mendapatkan perawatan khusus dari dukun bayi atau bidan.

34. She had a weakened immune system and was more susceptible to pneumonia.

35. Wala pa ba? seryoso niyang tanong.

36. Today we can watch games, shows, and song and dance programs from all corners of the world while sitting in our own homes.

37. Der er mange traditionelle ritualer og ceremonier forbundet med at blive kvinde i forskellige kulturer.

38. I complimented the pretty lady on her dress and she smiled at me.

39. Guarda las semillas para plantar el próximo año

40. Nagsisilbi siya bilang pari upang magbigay ng espirituwal na tulong sa kanyang mga parokyano.

41. Palibhasa ay magaling sa paglutas ng mga problema dahil sa kanyang mga analytical skills.

42. Coffee contains caffeine, which is a natural stimulant that can help improve alertness and focus.

43. Una dieta equilibrada y saludable puede ayudar a prevenir enfermedades crónicas.

44. Las hojas de afeitar deben cambiarse con frecuencia para evitar irritaciones en la piel.

45. Ang tubig-ulan ay maaaring magdulot ng pagkakatanggal ng mga mapanganib na mikrobyo sa mga kalsada at iba pang mga lugar.

46. Tumango tapos nag punta na kami sa may garden ng hospital.

47. Muntikan na akong mauntog sa pinto.

48. "Masaya ako na nakilala kita," ani ng bagong kaibigan ko.

49. The Tesla Model S was the first electric car to have a range of over 300 miles on a single charge.

50. Ang sugal ay naglalayo sa mga tao sa kanilang mga responsibilidad at mga mahahalagang gawain sa buhay.

Recent Searches

high-definitiondullbabydisyembrelegacydumaanilawpongbumigaynag-replymalihisbumabagpadabogpopularkahilingansonidoconsumekumukuloangkanparkekinainbumotowealthdevelopcivilizationtwo-partyisipasimmakasilongmanakboisulatpaglalayagemocioneshinamaktindahanpaaralanhumihingimbricosgagamitniyogbutimagalitbirthdaybighanipadalase-commerce,magisingtinikmantalinosteamshipstalagangxviipumikithiramniyonawitankalaroconvey,umuposandwichskillsnatatanawconclusion,promisetagumpaytiniklinggawingisinamatelephonechristmasbumalikbanalestadoskundimangumisingmabibingiriegabinabaratbook,observation,undeniablekumainkatibayangbiglaanincredibleeconomicherramientastagalgustongvegassahigdyosasementobawatsocietymahigpitperseverance,tuwidgandacontent,lungsodahhhhpangakovariedadhinampasnapahallayonmalayabiggestmalinisheymensajespagkakapagsalitapapuntakayang-kayangadvertising,gabi-gabitinatawagnag-aalangannananaginippagka-maktolnalulungkotkadalagahangmagpa-checkupnapakatagalpaglapastanganiloilopagsisisicrucialpagpilibumibitiwmakapalagnegro-slavesinvestingnakikianandayanalakiaplicacionesmawawalanovellespagkasabipambahaykatuwaanstrategiespanalanginngpuntaleaderspacienciapinagawamedikalproductividadforskel,nakakatandanangangalitairportkahuluganmatagpuanmedicaldiwatasinasabimanatiliarbejdsstyrkemakikituloggumawamakakibohayaanpinapataposmakaraanpawiindisfrutarsinaliksikseguridadumuwimagpagupittangeksmakasalanangyakapinactualidadumakbayasawaimportantenapapansintumiranami-misstumalimmaipapautanglinggongkisspamilyaclientesstylesresourcesdarkmichaelsarilingissuesserabslive