Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Las escuelas también tienen la responsabilidad de asegurar un ambiente seguro para los estudiantes.

2. Dumadating ang mga guests ng gabi.

3. Ang labi niya ay isang dipang kapal.

4. Sa kanyang pagsasalita, siya ay nagdudumaling ng kanyang mga salita upang maiparating ang kahulugan ng mensahe.

5. Les personnes âgées peuvent souffrir de diverses maladies liées à l'âge, telles que l'arthrite, la démence, le diabète, etc.

6. Ang pag-uusap namin ng aking kasintahan ay nagpawi ng aming hindi pagkakaunawaan at nagbigay-daan sa pagkakasunduan.

7. Maraming taong sumasakay ng bus.

8. Ngumiti siya at lumapit kay Maico.

9. Microscopes have been used to discover and identify new species of microorganisms and other small organisms.

10. Gracias por ser honesto/a y decirme la verdad.

11. Los sueños son el motor que nos impulsa a lograr nuestras metas. (Dreams are the engine that drives us to achieve our goals.)

12. Mange mennesker bruger påskeferien til at besøge kirkegårde og mindes deres kære.

13. Burning bridges with your ex might feel good in the moment, but it can have negative consequences in the long run.

14. Ngunit parang walang puso ang higante.

15. Hindi ko alam kung pano ito sasabihin, hindi na ako magpapaligoyligoy pa, si Helena ay wala na.

16. They are not hiking in the mountains today.

17. The level of sweetness can vary in different types of sugar and sweeteners.

18. Si Ben ay malilimutin pagdating sa mga petsa ng okasyon, kaya lagi siyang may kalendaryo.

19. They are a great way to use up leftover ingredients and reduce food waste.

20. Samantala sa kanyang pag-aalaga sa mga alagang hayop, nae-enjoy niya ang mga simpleng kaligayahan na hatid ng kanilang kakaibang personalidad.

21. Ang mga kawani ng gobyerno nagsisilbi sa publiko upang mapabuti ang serbisyo ng kanilang ahensiya.

22. Ang lecture namin sa klase ay ukol kay Andres Bonifacio at ang mahahalagang pangyayari sa kasaysayan.

23. Masaya akong pumasok sa silid-aralan dahil mahilig ako sa pag-aaral.

24. Ang talambuhay ni Manuel L. Quezon ay nagpapakita ng kanyang pagmamahal sa bayan at liderato sa panahon ng kolonyalismo.

25. A mi esposa le encanta hacer manualidades como pasatiempo.

26. Pagkatapos maligo, ang katawan ay nagiging mabango at malinis sa amoy.

27. Nangyari pa nagmistulang itong reyna kung utusan ang ama at ina.

28. Maruming babae ang kanyang ina.

29. Hindi dapat nating kalimutan ang ating mga pangarap kahit na nagbabago na ang ating mga prioridad sa buhay.

30. Ano ang gagawin ni Trina sa Oktubre?

31. Tumango lang ako at ngumiwi, Oo eh, hindi kasi ako sanay.

32. El control de las porciones es importante para mantener una dieta saludable.

33. ¿Dónde está el baño?

34. Pardon me, but I don't think we've been introduced. May I know your name?

35. Madalas mapagalitan si Jake dahil sa pagiging malilimutin niya sa trabaho.

36. Otro festival importante es el Festival Internacional de Música y Danza de Granada, que se celebra en junio y presenta una amplia variedad de géneros musicales

37. Mabilis nyang kinuha ang laptop upang tapusin ang kanyang nobela.

38. Some ailments are preventable through vaccinations, such as measles or polio.

39. Cada vez que cosechamos las frutas del jardín, hacemos una deliciosa mermelada.

40. Ang mga matatamis na melodiya ng kundiman ay nakakapukaw ng damdaming umiibig.

41. Today, mobile phones have become an essential part of everyday life, and they have greatly expanded the capabilities of the telephone

42. La fotografía es una forma de arte que utiliza la cámara para capturar imágenes y expresar emociones.

43. Los héroes están dispuestos a enfrentar los desafíos y luchar por lo que creen.

44. Sa pagkawala ng kanilang tahanan, naghihinagpis ang mga pamilyang apektado ng sunog.

45. Sopas ang ipinabalik ko sa waiter.

46. Naramdaman ko ang pagdidilim ng aking paningin nang biglang nagpakalma ang mundo sa aking paligid.

47. Ang galing nya magpaliwanag.

48. No tengo apetito. (I have no appetite.)

49. Labis na ikinatuwa ng mag-asawa ang biyayang ito,pangalanan nila ang bata na Rabona, pinaghalo ang pangalan ni Rodona at ang bundok ng Rabba.

50. Wag ka naman ganyan. Jacky---

Recent Searches

bangkobilibhigh-definitionnaiinitannaglabanantoyalayparangtrenbevarenaggalakasotupelobumigaypakealamtarcilanakabibingingginoongbitiwanlinggobarrocogivemeaningreachsemillasfionapancitbalitangbernardoso-calledinterestmasdanmagpuntalatestiniwansinunodcompostelafeedback,jamesspeedipipilitibabafonodayprospersamuperangsorryinternamaratingthoughtskitjohncommercecandidatemobilelibrebehindlumuwasmastermanagerskillsetsawareallowedtechnologiesserviceselectedanotherbutigovernmentkapilingutusanexampleberkeleyknowledgemediumdifferentamazoncontrolledginootumabagagagayunpamanpalancamagtatagalnagmamadalimakahiramyumabongnakatagomagsabihumiwalayinsektongkuwadernoumakbaysakaabundantetenniskannai-dialkampanakainitanminamasdanisagarbansosprimerasagam-agamagoslaruantagalogkaminasabingshopeehapag-kainannaiwangprinsipengsinabielitededication,imaginationbaduykausapinnakikini-kinitakaaya-ayangalingumuwinaglokohanilawnaghihirapmahihirapkaysalumipadrosepagkalungkotlabinsiyammanghikayatkwartosumusulatfiverrisinawakpalasyoprosesosmilesurroundingssharetagtuyotpaumanhiniguhitapoymiralangismagsusuotnamwowofficeobstaclesconcernsbulatepaceninumanitimmaraminapakatalinonakikilalangwalkie-talkielumiwanagnagpaalammakakatakasmababawpagpapakilalasahigmahiwagamakapalagkanikanilangpahahanapdumagundongmakipag-barkadamatapobrengalapaaphumalonagdaboglumayothanksgivingmahinangnakapasahinamaknaabotlikodmatumalpapalapithagdanantelecomunicacionesgawaingbilerkumananharapane-bookspagtatakafactorespamagat