Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Lungkut na lungkot ang buto sapagkat madilim na madilim sa loob ng kasoy.

2. El claroscuro es una técnica que utiliza contrastes entre luces y sombras para crear efectos tridimensionales en la pintura.

3. Hindi ko ho makain dahil napakaalat.

4. At have håb om at gøre en forskel i verden kan føre til store bedrifter.

5. The doctor prescribed antibiotics to treat the pneumonia.

6. El invierno es la estación más fría del año.

7. I heard that the restaurant has bad service, but I'll take it with a grain of salt until I try it myself.

8. Tango lang ang sinagot ni Mica. Bumaling sa akin si Maico.

9. Ano ang ininom nila ng asawa niya?

10. Naglalaba si Maria ng mga damit tuwing Linggo para sa buong pamilya.

11. Matapos mabasag ang aking paboritong gamit, hindi ko napigilang maglabas ng malalim na himutok.

12. Ano ang sasayawin ng mga bata?

13. Ang kundiman ay isang tradisyunal na awit ng pag-ibig sa Pilipinas.

14. Transkønnede personer kan opleve udfordringer i forhold til sundhedspleje og adgang til passende behandling.

15. It ain't over till the fat lady sings

16. The dog barks at strangers.

17. Binentahan ni Aling Maria ng prutas si Katie.

18. Ultimately, a father is an important figure in a child's life, providing love, support, and guidance as they grow and develop into adulthood.

19. Bawal mag-ingay sa loob ng liblib na lugar dahil ito ay nakakabulahaw sa mga hayop.

20. Luluwas ako sa Maynila sa Biyernes.

21. Ang mga anak-pawis ay kadalasang nakakaranas ng diskriminasyon sa lipunan.

22. Sa condo ko. nakangiti niya pang sagot.

23. Nagtitinda ang tindera ng mga prutas.

24. Napaluha si Aling Pising nang makita niya ang bunga nito.

25. Alam ko maraming uncertainties sa buhay, pero sana pwede ba kitang mahalin?

26. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

27. Les enseignants peuvent adapter leur enseignement en fonction des besoins et des niveaux de compréhension des élèves.

28. Para darle sabor a un guiso, puedes añadir una ramita de hierbas de tu elección.

29. The meat portion in the dish was quite hefty, enough to satisfy even the hungriest of appetites.

30. They have been running a marathon for five hours.

31. Punta tayo sa park.

32. The Grand Canyon is a breathtaking wonder of nature in the United States.

33. Napakamot na lang ng ulo si Kenji.

34. Bumibili ako ng malaking pitaka.

35. Dahil sa sobrang init, naglipana ang mga puting ulap sa kalangitan.

36. Smoking is a harmful habit that involves inhaling tobacco smoke into the lungs.

37. Labis na ikinatuwa ng mag-asawa ang biyayang ito,pangalanan nila ang bata na Rabona, pinaghalo ang pangalan ni Rodona at ang bundok ng Rabba.

38. The backpacker's gear was hefty, but necessary for their long trek through the wilderness.

39. Nagbigay ng pahayag ang alkalde ukol kay Maria tungkol sa mga plano para sa lungsod.

40. Sa bawat pagkakataon, dapat nating ipaglaban at ipagtagumpay ang ating kalayaan.

41. Les riches dépensent souvent leur argent de manière extravagante.

42. The actress on the red carpet was a beautiful lady in a stunning gown.

43. Ako ay nagtatanim ng mga halaman sa aking bakuran.

44. Natagpuan ko ang susi ko sa dakong huli ng aking bulsa.

45. Las personas pobres son más vulnerables a la violencia y la delincuencia.

46. Salamat sa iyo kaibigan, nailigtas mo ako sa kamay ng itim na salamangkera.

47. Pakibigay sa driver ang bayad ko sa pamasahe, wala akong abot.

48.

49. Las escuelas ofrecen programas educativos desde preescolar hasta la universidad.

50. Naging mayaman din ang mag-anak dahil sa mga bentang tela na ginagawa ng bata.

Recent Searches

high-definitionimagesdissepongkantoremainmaestrodemocracy1787blazingxixitinagofonosnangyaripinigilantinataluntonpakikipaglabantiktok,payongparagraphsoveralltonsorespeechesnahulinatanggapmallreboundinantokumiinitmagbungaprovidechavitmajorhumanospingganbuwalrichhelpfuladdressluisfinishedmillionstransparentkumarimotcomekapangyarihanumuulanumarawthreetalecrazydinalapeterstudentshimmaprefeffectulinginteractguidenakakabangonnagkakakainunahinpagtawaventabagsakiloilopinagalitanmahiwagamagsusuotmakatulogumiisodinvestpamagatbihiramakikitulogwondergawareynabarangayriyantignanganaelviskrusspentgodmalinisdintiposformaalignsitemshimselfnagkitatinatawagmakangitimiramusicianeskwelahankasalukuyannaglakaddadalawinhampaslupanapipilitanpagtataasmagpapagupitkatuwaanmananakawgumagamitnapasigawformlumamangibinilisasakyanaga-aganapatigilmangahasmagawacover,paaralanparusahanmaaksidenteniyanpinaulanansarongutilizanligaligshadesnatutomeronnochenagisingnuhparkebotanteoperahannangnatupadbalingnatingalaartssparelabanankumaripasjameskartonbabaamountrememberkoreabroadcastswalkie-talkiepagpapakalatnakakadalawmagkikitanamumulaklakngingisi-ngisingnapatawagmagtanghalianmakakawawanagkakasyamoviesmagnakawnakakagalingpamilyangopgaver,magbabagsikmamanhikannagpaalampagpapautangerhvervslivetpaga-alalaalas-diyesmaibibigaypagkagisingtungkodalapaapnagtataeinilistabyggetincluirmaanghangkusineronalugmokmumuntingnagbantaynakikianag-aagawanmakatatlonageespadahanimportag-arawbumilimagbantaypaglalabamensaherica