Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Claro que sí, estoy dispuesto a aprender cosas nuevas.

2. Peter Pan takes children on an adventure to Neverland, where they never grow up and encounter pirates and fairies.

3. Medarbejdere kan skifte karriere når som helst i deres liv.

4. Sa tulong ng isang magandang pagsasalita at pang-unawa, ang tensiyon sa pagitan namin ay napawi.

5. Bwisit talaga ang taong yun.

6. Mayroon ba kayong reaksiyon, Senador Ferrer?

7. Pinayuhan sila ng albularyo na magdasal bago mag-umpisa ang gamutan.

8. Teka anong ginagawa niyo dito? 9 na ha!

9. Ang Ibong Adarna ay nakapagbigay ng inspirasyon sa maraming manunulat at makata upang magsulat ng kanilang sariling mga obra.

10. Wala akong maisip, ikaw na magisip ng topic!

11. Wala yun. Di ko nga naisip na makakatulong. aniya.

12. Mahalaga ang listahan para sa mga malilimutin tulad ni Lita.

13. It's time to pull yourself together and start taking responsibility for your actions.

14. Sa anong tela gawa ang T-shirt?

15. Wala yun. Siya naman talaga ang may kasalanan eh.

16. Sa aming barangay, nagkaroon ng malawakang paglilinis ng kanal dahil sa bayanihan ng mga residente.

17. Los héroes son capaces de superar sus miedos y adversidades para proteger y ayudar a los demás.

18. Kill two birds with one stone

19. Kailangan nating magbago ng mga lumang gawi, datapapwat ay mahirap ito gawin dahil sa kawalan ng disiplina ng iba.

20. Nagtatampo na ako sa iyo.

21. Der er mange forskellige typer af helte.

22. Sweetness can be balanced with other flavors to create a harmonious taste experience.

23. She is not playing with her pet dog at the moment.

24. Nagpatingin ang bata sa albularyo matapos siyang makagat ng aso.

25. Les objectifs à long terme peuvent sembler écrasants, mais la division en tâches plus petites et plus gérables peut aider à maintenir la motivation.

26. Namamangha at nananaghili sa ganda ng magkakapatid ang mga dalaga sa kanilang nayon.

27. La creatividad es una habilidad que se puede desarrollar con la práctica y el esfuerzo.

28. Scissors can have straight blades or curved blades, depending on the intended use.

29. Sa mga tunog ng kundiman, nabibigyang-buhay ang mga kuwentong umiikot sa pag-ibig at pagdurusa.

30. Magkano ang arkila ng bisikleta?

31. Nakatingin silang lahat sa amin, Sabay kayong maliligo?!?!

32. Ang tubig-ulan ay nagbibigay ng natural na tubig sa mga lawa at ilog, na nagbibigay ng tahanan at pagkain sa mga isda.

33. Transkønnede personer kan opleve diskrimination og stigmatisering på grund af deres kønsidentitet.

34. Kaya't tama lamang na ito rin ay kanyang ipapamana sa nag-iisang anak.

35. The king's role is to represent his country and people, and to provide leadership and guidance.

36. Red horse? Ikaw? nagtatakang tanong ni Genna.

37. Si Padre Abena ang gusting umampon kay Tony at gusto rin niyang pag-aralin ito

38. Wag kang mag-alala.

39. Kung walang tiyaga, walang nilaga.

40. She enjoys taking photographs.

41. My coworkers and I decided to pull an April Fool's prank on our boss by covering his office in post-it notes.

42. They play video games on weekends.

43. Bakit sila makikikain sa bahay niya?

44. Eating healthy is an important way to take care of your body and improve your quality of life.

45. Matapos ang pangunahing pangyayari sa kabanata, nagkaroon ng bagong direksyon ang kuwento patungo sa susunod na yugto.

46. Hindi ka man makahanap ng kasama, mayroon kang kaulayaw sa loob ng puso mo.

47. Naging kaulayaw ko siya noong ako'y nag-aaral pa lamang.

48. Lumiwanag ang langit pagkaraang umalis ang ulan.

49. Sumama ka sa akin!

50. Marami silang pananim.

Recent Searches

makinangcarmenhigh-definitionlalongrabbaganitonapapikito-ordertamisnapakomaghintayjennybigkispolosilbingbaird1787hidingsaidleadingbalancesbingibasahindinanasredigeringhusoangkanmalumbaylookedbugtongputiloricolourproducirbranchesngpuntadinifaultsumapitibalikkwebangfakelabingtingaudio-visuallygisingkapilingulocommunicateguidehateexampledebatesiponggraduallyinfinitydoontalepdaideaauthortiposnothingpagtingindeliciosasharmainekalayuannakapasoknagmadalingpagpanhikpinagbigyannaulinigandiretsahangmatalinorevolutioneretmanghikayatmahihirapnaguguluhandalawadoingdatarequireinteligenteslargethreenariningcasesestablishedjunioclientesguiltyalincleancespinakabatangnagbanggaannagbabakasyonnakaupokasalukuyanpagsasalitadi-kawasaagwadorprovidednahulidependnakasahodhubad-baromonsignornakalilipasnanahimiklabing-siyampamilyangnakakatulongnapatawagikinakagalithila-agawanmaihaharapnaglipanangfilmnuonbutasgasmenhealthierkakapanoodberetiexpensesbasurabungadmagpasalamatnakatitiginilistapumiligasolinamahinanakikitangsinaliksikpilipinasnaiilangnaghihirapnaapektuhannakauwitumunognakapasapagkakatayooverbeendepartmentnagtaposdamdaminiligtaspaosnakangisingbinentahanalaganglumabasusuariohouseholdinterests,mangyaripangarapipinambilitmicasahigmaskaramenskontrapangalananpadalasisinaramusicalkalabantsinamatutongmagkasinggandapuedeskumilospaggawaanumanricomaongalagatelevisionilagaysementopampagandamatalimallesikatsarongbecameteachernasanklasengmatulissumisilipginaganoonbinibilangtusindvissalbahepalda