Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Kebahagiaan bisa ditemukan dalam momen-momen kecil sehari-hari.

2. Cancer can impact not only the individual but also their families and caregivers.

3. Mataas sa calcium ang gatas at keso.

4. Gracias por entenderme incluso cuando no puedo explicarlo.

5. Snow White is a story about a princess who takes refuge in a cottage with seven dwarfs after her stepmother tries to harm her.

6. Las escuelas también ofrecen programas de apoyo, como tutorías y asesoramiento académico.

7. Kung alam ko lang na ganito kasakit ang magiging parusa ko

8. Las serpientes son animales solitarios y, en su mayoría, evitan el contacto con los humanos.

9. Ang laki-laki ng cardigan na ito.

10. Magkano ang isang kilo ng mangga?

11. Sa gitna ng kaguluhan, hindi niya mapigilang maging tulala.

12. Ipinagbibili ko na ang aking bahay.

13. James Madison, the fourth president of the United States, served from 1809 to 1817 and was known as the "Father of the Constitution."

14. Erfaring har lært mig, at kommunikation er nøglen til en vellykket virksomhed.

15. La música es una forma de arte que ha evolucionado a lo largo del tiempo.

16. Ang kaibuturan ng kanyang pagkatao ay hindi mo agad makikita.

17. Agosto pa lamang ay may mga pang paskong dekorasyon na sa mga malls.

18. Ang malalakas na hagupit ng hangin sa gitna ng bagyo ay binulabog ang mga puno at nagdulot ng pagkasira sa mga istraktura.

19. Good morning, Beauty! aniya sabay halik sa mga labi ko.

20. Agama sering kali menjadi sumber inspirasi dan motivasi bagi individu dalam menghadapi tantangan hidup dan mencari makna dalam eksistensi mereka.

21. Hiram muna ako ng libro na iyon bago ko desisyunang bilhin ito.

22. She donated a significant amount to a charitable organization for cancer research.

23. La esperanza es un recordatorio de que siempre hay algo bueno en el futuro, incluso si no podemos verlo en el momento. (Hope is a reminder that there is always something good in the future, even if we can't see it at the moment.)

24. Drinking enough water is essential for healthy eating.

25. Pagkatapos maligo, ang katawan ay nagiging mabango at malinis sa amoy.

26. Nous avons besoin de plus de lait pour faire cette recette.

27. The tech industry is full of people who are obsessed with new gadgets and software - birds of the same feather flock together!

28. Lumabas na ako ng cr. Nakatayo lang ako dun.

29. Hindi ko maiwasang magtaka kung bakit may mga taong nagpaplastikan pa rin kahit alam nilang hindi sila magkakasundo.

30. I am not planning my vacation currently.

31. She has been cooking dinner for two hours.

32. Today, Presley is widely considered to be one of the most important figures in American music and culture

33. Dwayne "The Rock" Johnson is a former professional wrestler turned actor, known for his roles in films like "Jumanji" and the "Fast & Furious" franchise.

34. Me gusta salir a caminar por la ciudad y descubrir lugares nuevos, es un pasatiempo muy entretenido.

35. AI algorithms are constantly evolving and improving, with new advancements being made in fields such as deep learning and reinforcement learning.

36. Ang pagtanggi sa mga paniniwala at opinyon na hindi pabor sa sarili ay nagpapakita ng pagiging bulag sa katotohanan.

37. The company's acquisition of new assets was a strategic move.

38. Ang parusang angkop sa suwail na anak ay iginawad.

39. Patunayan mo na hindi ka magiging perwisyo sa kanila.

40. Binigyan ni Jose ng pera si Bob.

41. Gusto ko hong magpapalit ng dolyar.

42. All these years, I have been blessed with experiences that have shaped me into the person I am today.

43. Hindi ko alam kung kakayanin ko, pero sana pwede ba kitang mahalin?

44. Pilit mang hinila ng prinsipe ang kamay ay di nito magawang makawala sa pagkakahawak ng prinsesa.

45. Dalam menghadapi tantangan, penting untuk memiliki dukungan sosial dan lingkungan yang positif.

46. El realismo y el impresionismo son estilos populares en la pintura.

47. Eksport af teknologi er en stigende del af den danske eksport.

48. Iboto mo ang nararapat.

49. It's never a good idea to let the cat out of the bag when it comes to confidential information - it can have serious consequences.

50. Nakakabahala ang mga posibleng epekto ng kanilang plano kaya ako ay tumututol.

Recent Searches

high-definitiontambayanhundredalayplasabangkokubyertosagesnaglalabaasignaturasentenceiikliailmentsniligawanredigeringarbejdermalambingvelstandbasahinbinasasantosinunud-ssunodpeepestarclaseshangaringprimermassesattentioniguhitmoderneresignationemailnatandaanabstainingcoaching:heymentalcompartenmagpuntaparagraphslegendscoatyesninyointyaininilingoverviewdinalastudentsviewsgameleeconectanfistsbehaviorberkeleyablemotionstreamingjohngenerabaamazonhimighumanorawpagtatanimleahfactoreskanikanilangsumusunodimagessyncnamingmalungkotnatulogbreakskyldes,ikinalulungkotnewjuanasampaguitanaroondolyarpinyadesign,inspirasyonnag-angatspentumiyakkuwentobalediktoryanmagtakapangilhimihiyawdisfrutarnailigtasnasasalinanpanalanginkabutihanibinilitinutopmaipagmamalakingnaabutanpagpanhiknapipilitanpamburamagkahawakmakakatakasbaku-bakongmisteryomakipagtaloeskuwelasasagutininasikasomakasilongpagngitinapapatungonagpaiyaktuluyanerlindaadmiredtinungopasaheropinangalanannapahintotumatakbonatatawamaghahabiberegningermagdamaguniversalpaulaprogramming,communicatealmacenarlibertysantossocialesbluesvictoriaginawanglolamagtatakapwestonakauslingpahabolnabuhayibabatantanangumandagawinngunitalinliboarbularyorhythmmagandanatitirangpinaulanankastilamaawaingbanalnangagsibilimbricosxviibuhawipaliparinkaybilisshoppingjolibeedealmagdilimpulongtaksiundeniablenuevohigacleannakakaakithelped1960ssumimangotipinamilibaryogreatlyreynakutsilyopaskongpagputililysagapaffiliatewinsmakulitmatitigaspanahonnapakatalinonagdarasalhdtv