Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Algunas serpientes son capaces de desplazarse en el agua, mientras que otras son terrestres o arbóreas.

2. Naku, may boyfriend ako eh. sabi ko.

3. Anong kulay ang gusto ni Merlinda?

4. He drives a car to work.

5. Ang pag-asa ay nagbibigay ng inspirasyon sa mga tao upang maglingkod sa kanilang komunidad at sa ibang tao.

6. Nagtayo ng scholarship fund si Carlos Yulo para sa mga batang gustong mag-aral ng gymnastics.

7. Bumili kami ng isang mapa ng kalakhang Maynila para mas magaan ang pag-navigate sa lungsod.

8. Nagsimula ang programa sa dakong huli ng gabi.

9. La fotosíntesis es el proceso mediante el cual las plantas convierten la luz solar en energía.

10. Después de varias semanas de trabajo, finalmente pudimos cosechar todo el maíz del campo.

11. Sa aksidente sa kalsada, maraming tao ang nasugatan at ilang pasahero ang namatay.

12. Kalong nito ang kanyang kapatid na bunso.

13. Anak, iwasan mo si Don Segundo, baka ikaw ay mapahamak, pagpapaalaala ng nangangambang ina.

14. Ang pagkikita at pag-uusap sa isang propesyonal na tagapayo o therapist ay nakagagamot sa aking emosyonal na kalagayan.

15. James A. Garfield, the twentieth president of the United States, served for only 200 days in 1881 before his assassination.

16. Ang pagkakaroon ng kinikilingan sa kabila ng malinaw na ebidensya ay nagpapahiwatig ng pagiging bulag sa katotohanan.

17. It was founded by Jeff Bezos in 1994.

18. Ailments can be prevented through healthy habits, such as exercise, a balanced diet, and regular medical check-ups.

19. Sa kulturang Pilipino, ang punong-kahoy ay kinikilala bilang simbolo ng kalikasan at pagiging matatag.

20. The team is working together smoothly, and so far so good.

21. Tila hindi siya kumbinsido sa iyong paliwanag.

22. It is a form of electronic communication that transmits moving images and sound to a television set, allowing people to watch live or recorded programs

23. Pumitas siya ng bunga at pinisil ito hanggang sa lumabas ang laman.

24. Ngunit nagliliyab pa rin ang poot sa kanyang mga mata.

25. They are not building a sandcastle on the beach this summer.

26. Investing requires discipline, patience, and a long-term perspective, and can be a powerful tool for achieving financial goals over time.

27. "Hindi lahat ng kumikinang ay ginto," ani ng matandang pantas.

28. Can you please stop beating around the bush and just tell me what you really mean?

29. Let's not make this into a big deal - it's just a storm in a teacup.

30. He plays chess with his friends.

31. Inutusan nga lang ho niya kong bumili ng ulam, para mamayang tanghali.

32. Alas-tres kinse na po ng hapon.

33. Les outils de reconnaissance faciale utilisent l'intelligence artificielle pour identifier les individus dans les images.

34. Isang araw, umuwing mainit ang ulo ng binatilyong apo dahil natalo sa sugal.

35. Nakalimutan ko na ang pakiramdam ng hindi paghahanda sa agaw-buhay na pag-ibig.

36. The elephant in the room is that the company is losing money, and we need to come up with a solution.

37.

38. Some businesses and merchants accept cryptocurrency as payment.

39. Ano ho ba ang itsura ng gusali?

40. Matagal na kitang pinapanood at ngayon lang ako maglalabas ng katotohanan - may gusto ako sa iyo.

41. Naku hindi na po. Ayos lang po ako.

42. The bride usually wears a white wedding dress and the groom wears a suit or tuxedo.

43. Sa pagpapahalaga sa ating kalayaan, kailangan din nating bigyan ng halaga ang kalayaan ng iba.

44. Ang kanilang pagmamahalan ay animo'y walang hangganan, kahit sa anong pagsubok na dumaan.

45. May gamot ka ba para sa nagtatae?

46. Ang kanilang panaghoy ay tinugunan ng tulong mula sa mga taong may mabubuting puso.

47. Anong pangalan ng lugar na ito?

48. Ang pagiging maramot sa kaalaman ay nagiging hadlang sa tagumpay ng iba.

49. "Walang imposible basta may tiyaga," ani ng isang matagumpay na negosyante.

50. Puwede ba sumakay ng taksi doon?

Recent Searches

high-definitionnaglabanandilawkungbulaknatatanawmensinterests,iiwasansagutinkangkongaccedermemobisigorugaradiosaidalexandermulimarchbipolarbienfertilizerdagafakesameinaapiworkshopreaddahilmonetizingpilinghagdanpagbabagong-anyopagsasalitamaliittigilmakatulongmensajesnagpuyosmakakakainlabing-siyampanalanginnalakipinapalobulaklakkapasyahannagdiretsoproductslagunamatesahelpedmadalingtagakinatakenapagsilbihannanaisintumigilhayaangpagsubokmakaraantangekspangungusapnakikitangcompletamentepinoyexperience,paakyatsikatmahigpitnagpapasasatillmaawagraphicpalagimembers1954iatfpopulationkilocomunespartneroftespaghettiseparationhalamanyumabonghinintayamparogiraypunong-punopigingnakahainleoliigihahatidsenadormalilimutindatanagdaostrafficmarylargernangyarikomedorblazingcontroversymagalitarbularyotuwingmayaipipilitresultsocialglobehotdogprogramming,dagatkundiguroadobokasakitparinsaan-saanideyanakatiraespanyanggrownagpupuntaalasreserbasyonlalakadslavegamitinyumaocontent,nasagutanengkantadangnakaraanmaibalikcommercestatinggraduallymainstreamsensiblecallposternapakamisteryosonalulungkotpresidentialnaglalatangkinamumuhiangratificante,nag-iyakanfallnamumulotmagbayadkagalakanmakahiramkaloobangbangkomasaksihannagbantaynakatagokuwadernonakangisihampaslupatumahantumalimngumiwinapapahintouugod-ugodmahiyaproductividadmagdamagintindihinmagpasalamatpusangmagpahabanagsmilenailigtasnakangisingpropesorkampanaika-12maghihintaymaasahankahoycornerkastilamabibingipaliparinnaglulusakgovernorsoperativosininommagsaingnapakokaniyanahantad