Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. La labradora de mi vecino siempre se emociona cuando ve a alguien llegar a casa.

2. Nakapag-travel ako sa ibang bansa kaya masayang-masaya ako ngayon.

3. Nahuli na nang mga pulis ang mga nagtutulak ng illegal na droga sa kanilang lugar.

4. Many companies use the stock market to raise capital by issuing new shares of stock to investors.

5. I heard that he's not trustworthy, so I take everything he says with a grain of salt.

6. After months of hard work, getting a promotion left me feeling euphoric.

7. He served as the 45th President of the United States from 2017 to 2021.

8. Tumaba sila ng tumaba hanggang sa tuwing maliligo kahit na pa tatlong tao lang sa sapa ay umaapaw agad tubig.

9. L'hospitalisation est une étape importante pour de nombreuses personnes malades.

10. El nuevo libro de la autora está llamando la atención de los lectores.

11. Les enseignants peuvent organiser des projets de groupe pour encourager la collaboration et la créativité des élèves.

12. Si Rizal ay naglakbay sa Europa at nakikipag-ugnayan sa mga kilalang intelektuwal at lider sa paglaban sa kolonyalismong Espanyol.

13. Bumisita kami sa mga kaibigan namin sa kanilang bahay sa hatinggabi.

14. My co-workers organized a surprise birthday party for me at the office.

15. Ang trahedyang naganap sa kanilang komunidad ay nagdulot ng pangmatagalang lungkot sa kanilang mga puso.

16. I have been swimming for an hour.

17. Sa takipsilim naglalakad ang matanda sa tabing-dagat.

18. Sila ay nagsisilbing modelo ng katapangan, katapatan, at pagmamahal sa bayan.

19. Nagtatanim ako ng mga bulaklak sa mga paso upang magkaroon ng mga colorful na dekorasyon sa loob ng bahay.

20. Tuwing tag-init, maraming bata ang naglalaro ng saranggola.

21. Maaaring magkaroon ng interest at late fees kapag hindi nabayaran ang utang sa tamang panahon.

22. Dapat natin kontrolin ang pagmamalabis sa paggamit ng social media upang hindi ito makaapekto sa ating mental na kalusugan.

23. It has revolutionized the way we communicate and has played a crucial role in shaping modern society

24. Ano ho ang gusto ninyong bilhin?

25. The tech industry is full of people who are obsessed with new gadgets and software - birds of the same feather flock together!

26. Las plantas desempeñan un papel fundamental en el ciclo del agua, absorbiéndola del suelo y liberándola a través de la transpiración.

27. Ano ho ang ginawa ng dalawang babae?

28. El maíz es propenso a ataques de plagas como la oruga y la langosta del maíz

29. Ang pagdating ng mahigpit na bagyo ay nagdulot ng malalakas na alon at binulabog ang mga bayan sa tabing-dagat.

30. Sa wakas, aalis na si Ogor, naisip niya.

31. Ayon sa mga ulat, may paparating umano na bagyo sa susunod na linggo.

32. Sus gritos están llamando la atención de todos.

33. Ang karagatan ay malalim at malawak na lugar na puno ng buhay-alon.

34. Napasuko niya si Ogor! Napatingala siya Abut-abot ang pahingal.

35. No hay peor ciego que el que no quiere ver. - There's none so blind as those who will not see.

36. Matagal ko na syang kaibigan sa Facebook.

37. Sayang, tolong ambilkan aku air minum. (Darling, please get me a glass of water.)

38. El muralismo es un estilo de pintura que se realiza en grandes superficies, como muros o paredes.

39. Si Andres ay pinagpalaluan ng kanyang mga kaibigan dahil sa kanyang tapang at determinasyon.

40. Tinutukoy niya ang tarangkahan ng opisina kung saan sila magkikita.

41. We need to reassess the value of our acquired assets.

42. Lumingon ako sa kanya. Kita ang paga-alala sa mga mata niya.

43. The dancers are rehearsing for their performance.

44. Foreclosed properties can be a good option for those who are looking for a vacation home or second property.

45. Ang mga construction worker nagsisilbi upang magtayo ng mga gusali at imprastraktura.

46. Hindi ko mapigilan ang aking inis kapag nakikita ko ang kawalang-katarungan.

47. Ang poot ay sumisindi sa aking puso sa tuwing naalala ko ang mga pagkakataon na ako'y iniwan at sinaktan.

48. Pagod na ako at nagugutom siya.

49. Ang paggamit ng droga ay madaling simulan, ngunit mahirap nang itigil.

50. Naroon sa tindahan si Ogor.

Recent Searches

high-definitionpebrerohomeangelatibigboto1876alexanderasomournednakatuwaangconventionalfakeritwalorugababespwedehulingiginitgiteveningpinalakingactivitygawainmusiccomputerenaidlipdahonlumahoksamakatuwidpaksahinintaynangmarahiltayomaliitmaibalikgawaingblesssayaagaddoktornagbasarumaragasangsapagkatnapadpadtagaytaynakabibingingpasensiyaoliviaipatuloyimportantesnagreklamopagkahaponapakagagandaproducerergatasnangingisaypleasenag-away-awayngitiiginawadgloriainiangatmalasutlamangingisdatusonggasmenibilininawalkie-talkiesilyamagkaparehoeffectspinagpatuloymagandasenadorbeautytaga-hiroshimadatapuwanatuyopasigawtipidvideos,naglalakadtraditionaldyosafavoripinakitatag-ulanawarddiapernagdaossinamaidtiningnancolororkidyasalaalareguleringaumentartumingalaplagasbooksupuanumulanrightszoomrevolutionizedbansangshinesginisingipinabalikpasanwidespreadctricasmasasakitstuffedpalayanpapuntaphysicalbataestasyonwastekaniyamayseensimplengaidartificialfeedbackrosasnakakatakotganitojustinawitantumalonnasabinghapdiaminboxingkainanmedievalaktibistalumalakinapakamotdaminaramdamrelevantlandosigepinilipunung-punoginamotnatutulogsandokkundimanfollowedhoynabiawangsumisidkriskamaisiphimayinathenakumaliwamaibigaygngkananguminomjolibeenagtakatumunognapatayoleksiyongawinbatipitakanagdaramdamkaguluhanclasespieceskatawangpakikipagtagponakauponag-aalalangnapakamisteryosorelopinabayaanmakangitimakahiramnagtatampospiritualpresidentialkinamumuhiankagalakanpagsumamoobservererkaloobangdali-dalisang-ayon