Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Electric cars can support renewable energy sources such as solar and wind power by using electricity from these sources to charge the vehicle.

2. Marahil ay maulan bukas kaya't dapat magdala ng payong.

3. Ang pagtitiwala, ayon sa karanasan.

4. Naghahanap ako ng kailangang gamitin at hinugot ko mula sa baul ang mga ito.

5. Meskipun mayoritas Muslim, Indonesia juga memiliki komunitas yang kuat dari agama-agama lain yang berkontribusi pada keragaman budaya dan sosial.

6. Matagal-tagal ding hindi naglabada ang kanyang ina, nahihiyang lumabas sa kanilang barungbarong.

7. Tim Duncan was a fundamental force in the NBA, leading the San Antonio Spurs to numerous championships.

8. Mainit sa Pilipinas sa buwan ng Abril.

9. Si Rizal ay naglakbay sa Europa at nakikipag-ugnayan sa mga kilalang intelektuwal at lider sa paglaban sa kolonyalismong Espanyol.

10. Marahan niyang inalis sa pagkakakawit ang mga balde.

11. Taon-taon ako pumupunta sa Pilipinas.

12. Sige, tatawag na lang ako mamaya pag pauwi na ko..

13. He realized too late that he had burned bridges with his former colleagues and couldn't rely on their support.

14. Nagbigayan kami ng mga regalo noong Pasko.

15. Ibinigay ko ang aking tulong sa mga naghihirap upang masiguro ang kanilang kaligtasan.

16. Ang kamalayan sa kanyang pangalan at nagawa ay naging inspirasyon para sa maraming henerasyon ng mga Pilipino.

17. Sabay nanaog at pumitas ng halaman sa hardin at nagtuloy sa ilog upang pagmasdan ang bulaklak sa kanyang buhok.

18. Ano na nga ho ang pamagat ng palabas ninyo?

19. Naku, hindi. Labinsiyam na ako.

20. Hindi ko maintindihan kung bakit may mga taong ganito mag-isip.

21. Patuloy ang labanan buong araw.

22. Aller Anfang ist schwer.

23. May lagnat, sipon at ubo si Maria.

24. La conciencia nos ayuda a entender el impacto de nuestras decisiones en los demás y en el mundo.

25. Mathematics can be used to analyze data and make informed decisions.

26. Nakatanggap umano siya ng isang liham mula sa isang taong matagal nang nawala.

27. Hindi ko inakala na magkakaroon ako ng ganitong pakiramdam, pero crush kita.

28. This has led to increased trade and commerce, as well as greater mobility for individuals

29. I've been following the diet plan for a week, and so far so good.

30. Hindi ko alam kung kakayanin ko, pero sana pwede ba kitang mahalin?

31. La música es una forma de arte que ha evolucionado a lo largo del tiempo.

32. Just because she's quiet, it doesn't mean she's not intelligent - you can't judge a book by its cover.

33. Pagkatapos siyang kausapin ng hari ay dumeretso si Nicolas sa simbahan at siya ay nagdasal.

34. Napangiti siyang muli.

35. Ice for sale.

36. Gusto ko na umuwi ng Pilipinas.

37. Ang pagiging maramot ay hindi maganda lalo na kung may nangangailangan.

38. Natapos ko ang aking trabaho sa opisina sa hatinggabi dahil marami akong backlog.

39. He has painted the entire house.

40. I thought about going for a run, but it's raining cats and dogs outside, so I'll just stay inside and read instead.

41. Humarap sakin si Nathan, Kumain na ba kayo?

42. Matayog ang lipad ng saranggola ni Pepe.

43. Ang sabi nya inaantay nya daw girlfriend nya! Ang sweet!

44. Some people find fulfillment in volunteer or unpaid work outside of their regular jobs.

45. Setiap tantangan membawa pelajaran berharga yang dapat digunakan untuk menghadapi tantangan berikutnya.

46. Limitations can be addressed through education, advocacy, and policy changes.

47. Mag-uusap kami sa makalawa ng tanghali.

48. Tuwing sabado ay pumupunta si Nicolas sa palasyo para dalawin si Helena.

49. Smoking is more common among certain populations, such as those with lower socioeconomic status and those with mental health conditions.

50. Hindi ako masyadong mahilig sa pagpupuyat sa hatinggabi dahil masama ito sa kalusugan.

Recent Searches

high-definitionmagnifylumilipadkampanamanagerjeetoperativosnamumulotmakausapnakapikitgrabetrackpartneremailiosvotesfuncionarlabing-siyamautomatiskagilaoutlineroboticcorrectingmanalexandersetadditionallyparindavaoventaaktibistaprinsesamemorialinterests,hitanakabulagtangpotaenabutasparehaskinikitanakapagreklamoempresasipinakoreadersmusicalteacherdiliginkakuwentuhanbangkaamerikacinetransportcultivokikitapagsasalitapigilaneksempelplanning,pinangalanangpakilagaynakakakuhatoohanapinmaalwangisasabadinatupagpapuntaestilosmataaasleadingmakikiraanjingjingangkankanginananigaseveningsuwailmariteskontrapanindabinanggakasintahanbiyernesnizmicasominangipagbilipambatangnakikihalubilopagpapaalaalaleytekaramihanbillnagpapaniwalanaliligokaniyaumutangmaasahanmagsalitanagbungathenkinantalasapaki-drawingstringsabongisaacdatisumayawsmokingagawpagkakapagsalitanatitiyakminuteplasamumomagkabilangnaunamahagwaybroughtordersomepakainpaboritodiversidadpayongipanliniseditorbopolsmaibibigaydisensyokababayannagsisihanberetibulsaeksperimenteringpagtutoliconsnilinisnagiislowitinaobwingspecifictabing-dagatpinakamaartenggottaun-taonteleviewingadoptedpaki-translatepagtatanimmangahastagsibolorugaclientegatherpaslittumingalapaskomanilbihanabut-abottaingakakutisnasundopagodbighanipagkakalutohanapbuhayrevolutioneretpag-aaralabutantalagabagkusneaopisinapadabognaguguluhanmemooffernanlilimosdarknutrientesatentongisiilocosngabetatinaasanneedsginaganoonmagnakawmrsnalugmokmadulasnatulakdetectednapasubsobmagsimulaumuulan