Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. The moon shines brightly at night.

2. Indonesia dikenal dengan pantai-pantainya yang indah dan airnya yang jernih, seperti Bali, Lombok, dan Gili Islands.

3. Pahiram ng iyong sasakyan, wala akong ibang masasakyan pauwi.

4. Ang kundiman ay isang tradisyunal na awit ng pag-ibig sa Pilipinas.

5. Ahh nasa shower kasi si Maico sinagot ko na baka impor...

6. Gusto ko pumunta ng enchanted kingdom!

7. Hindi ka sigurado sa desisyon mo? Kung gayon, pag-isipan mo itong mabuti.

8. His presidency saw significant economic growth before the pandemic, with low unemployment rates and stock market gains.

9. Dapat lamang kayong maging kauri ng hayop, ang wika ng babaeng diwata pala ng ilog.

10. Las labradoras son perros muy curiosos y siempre están explorando su entorno.

11. Salamat po at pinagbigyan nyo ako.

12. Smoking cessation programs and resources are available to help individuals quit smoking, such as nicotine replacement therapy and counseling.

13. Forgiving someone doesn't mean that we have to trust them immediately; trust needs to be rebuilt over time.

14. Nag-ugat sa puso ni Durian na mahalin ang sakop ng kanyang ama.

15. Håbet om at finde vores sande formål kan føre til stor personlig opfyldelse.

16. The Niagara Falls are a breathtaking wonder shared by the United States and Canada.

17. El uso de drogas puede ser un síntoma de problemas subyacentes como depresión o ansiedad.

18. May galak na sumusuno sa kanyang dibdib habang pinagmamasdan ang pagkapuno ng sinundang balde.

19. Cryptocurrency is often subject to hacking and cyber attacks.

20. Ang maliit na mesa ang nasa kuwarto.

21. Kapatid mo ba si Kano? isasabad ng isa sa mga nasa gripo.

22. Las personas pobres a menudo tienen acceso limitado a oportunidades de trabajo y formación.

23. Effective communication and teamwork are important for a successful and productive work environment.

24. Ramon, nanaisin ko pa na sila'y magbagong-anyo kaysa tuluyang mawala na sa atin.

25. Hello love birds! bati ko sa kanila nang makalapit ako.

26. Naririnig ko ang halinghing ng mga kalahok sa obstacle course race.

27. Has she met the new manager?

28. Las personas pobres a menudo enfrentan discriminación y estigmatización en la sociedad.

29. Be my girl, Jacky. bulong niya sa tenga ko.

30. Nakakain ka ba ng mga pagkaing Pilipino?

31. Monas di Jakarta adalah landmark terkenal Indonesia yang menjadi ikon kota Jakarta.

32. Binibigyan niya ng halaga ang bawat oras na pinagsisikapan niya upang maging mabuting ina.

33. Las redes sociales pueden ser una herramienta para hacer networking y hacer crecer tu carrera.

34. Yumabong ang pagpapahalaga sa kalusugan ng mga tao dahil sa mga kampanya para sa mga aktibidad sa fitness.

35. El internet ha cambiado la forma en que las empresas interactúan con sus clientes.

36. Nagpatingin ang bata sa albularyo matapos siyang makagat ng aso.

37. Tatlong linggo kami dito sa Pilipinas.

38. Las heridas por quemaduras pueden necesitar de tratamientos específicos, como el uso de cremas o apósitos especiales.

39. Meskipun tantangan hidup tidak selalu mudah, mereka memberikan kesempatan untuk menjadi versi yang lebih baik dan lebih kuat dari diri kita sendiri.

40. Ang hilig mong mang hiram ng gamit tapos di mo naman binabalik!

41. Money is a medium of exchange used to buy and sell goods and services.

42. Ang mga tagapangasiwa sa komunidad ay nag-organisa ng isang pulong upang tanggapin ang mga mungkahi ng mga residente.

43. Langfredag ​​mindes Jesus 'korsfæstelse og død på korset.

44. The amount of knowledge that exists in the world is immeasurable.

45. She spilled the beans about the surprise party and ruined the whole thing.

46. Electric cars can help reduce air pollution in urban areas, which can have positive impacts on public health.

47. Kailan libre si Carol sa Sabado?

48. Hugh Jackman is best known for his portrayal of Wolverine in the "X-Men" film series and his Tony Award-winning performance in the musical "The Boy from Oz."

49. Sa tapat ng posporo ay may nakita silang halaman na may kakaibang dahon.

50. Las hierbas de provenza son una mezcla de distintas hierbas secas, ideales para condimentar platos.

Recent Searches

kunghigh-definitionknowsgayunmanmagtatapospulang-pulatigasnaiinitannapadpadkilokatulongpinakabatangellariyankaninawashingtonnilayuanpasangdilimdeletingtiradorlasinggeroalindiyaryowondernakaririmarimtriplargelori1940pagodcarenagandahanobstacleswaliserlindapalancadiploma1920sjingjingtrainspagkaawaelecttumakaslumagosasambulatmagdamagenergipadabogdyipnilibangankalanyounginiangatmakatarungangnagpuntahanmasinopnapahingasumasaliwmalamanghangaringdalhiniikotnapakasinungalingmadamotkumukulogearginangpaparusahanbalitanglarangansingaporepinakamatabangiyongplatformsroqueandamingmagbibiladnakangangangnobodymadalasaniyainalalayanditohinilakalabandinadaanandinadasaldaramdaminbanlagmagitingpaglalabadahimselfganangpaparamilockdownadangmaraminginformednapaangatmungkahiinaasahangbiroreceptortinayangalartsnapabuntong-hininganaidlippaghangamadilimkailangankarununganatinchavitamashiftkelanganmabaitselebrasyonsementongpagsasalitakuwartolamigmagtigilcasesmisamawalakanilangmagdaraosyouthpinangaralantungawpinag-aralanasiapa-dayagonaldadalohumabinagsuotnabuhayestablisimyentodollaryou,fascinatingsyainilagaypanunuksokontinggagamitexpectationsnutrientesmaidmagpakasalpaglapastanganvideoskomunikasyonconsideredmapaibabawidea:tsuperinamininalagaannagtalunancover,magbigaygarbansosnaglalakadtunaydawtinalikdanpasalamatanlateaywanumiwaspabalangpeacesinakagandahanlaruanpatakasmaghihintaynag-replycapacidadesvitamindumatingnalangmatigastubigsimplengpagkatakotsinuothacermotionchristmassimonnanaisinkapit-bahaydemroofstockgumising