Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Wow, talaga? Para kayong vampires, sa gabi nabubuhay.

2. Sa pagguhit, puwede ka rin mag-experiment ng iba't-ibang kulay at matutunan ang mga color combinations.

3. Kung kasamaan pa rin ang nasa iyong pagiisip, sanay huwag kanang makatayo.

4. May luha siya sa mata ngunit may galak siyang nadama.

5. Kailangan kong tapusin ang ginagawa ko.

6. Bilang paglilinaw, hindi mandatory ang pagsali sa aktibidad na ito.

7. Ang taong may takot sa Diyos, ay hindi natatakot sa mga tao.

8. Cuídate mucho en el camino, maneja con precaución y no te distraigas.

9. Hindi maganda ang amoy ng damit kung hindi ito maayos na naglalaba.

10. Bakit hindi? ang natigilang pagtatanong ni Mariang Maganda habang pinagmamasdan ang malungkot na mukha ng prinsipeng kanyang iniibig.

11. Sa ganang iyo, bakit hindi lahat ng tao ay pantay-pantay ang oportunidad sa buhay?

12. Dali na, ako naman magbabayad eh.

13. Miguel Ángel Buonarroti fue un artista italiano del Renacimiento.

14. Ang taong lulong sa droga ay parang nasa bangin na patuloy na bumababa hanggang sa wala na siyang mahawakan.

15. Masyadong maluwang ang pantalon na ito.

16. Il peut y avoir des limites d'âge pour participer aux activités de jeu.

17. Los teléfonos móviles, también conocidos como celulares, son probablemente los tipos de teléfonos más comunes en la actualidad

18. Bumisita kami sa museo at kinuha ang libreng mapa ng mga eksibit.

19.

20. She had a weakened immune system and was more susceptible to pneumonia.

21. My sister gave me a thoughtful birthday card.

22. In recent years, the Lakers have regained their competitive edge, with the acquisition of star players like LeBron James and Anthony Davis.

23. Women's health issues, such as reproductive health and breast cancer, have received increased attention in recent years.

24. The uncertainty of the future can cause anxiety and stress.

25. Ang daming bawal sa mundo.

26. Napapalibutan ako ng poot habang pinagmamasdan ko ang mga taong nagtataksil sa akin.

27. Ang pag-asa ay nagbibigay ng kahulugan sa buhay ng mga tao sa pamamagitan ng kanilang mga pangarap at mga layunin.

28. Ang taong lulong sa droga ay parang nasasakal na kaluluwa na patuloy na hinahanap ang paraan para lumaya.

29. Sa aming bakuran, nagtatanim kami ng mga tanim na pampalasa tulad ng luya at sibuyas.

30. Nagkatinginan ang mag-ama.

31. La música es un lenguaje universal que trasciende las barreras del idioma y la cultura

32. You need to pull yourself together and face the reality of the situation.

33. Hindi ko mapigilan ang sarili ko na mahumaling sa mga Korean dramas.

34. Sa bahay ni Pina ang salu-salo.

35. Sang-ayon ako sa opinyon mo tungkol sa pagsasama ng magkaibang relihiyon.

36. Nagreport sa klase ang mga grupo nang limahan.

37. Tinuro ng aking lola kung paano magluto ng suman gamit ang pulotgata.

38. Pedro at Juan ang mga pangalan namin.

39. Ngunit naglahong parang bula si Pinang.

40. Hindi umimik si Lory sa mga tanong ni Chad.

41. Hinampas niya ng hinampas ng kidkiran ang binatilyong apo.

42. Si Hidilyn Diaz ay naging inspirasyon din sa iba’t ibang mga atleta sa buong mundo.

43. May mga taong naniniwala na ang digmaan ay hindi ang solusyon sa mga suliranin ng mundo.

44. Sa simula ng kabanata, ipinakilala ang bagong karakter na magiging pangunahing tauhan.

45. Ang tamang dami ng pagtulog ay nakakatulong sa pagpapalakas ng immune system.

46. Hindi ko naiintindihan kung ano ang magiging resulta ng kanilang plano kaya ako ay tumututol.

47. The Lakers' success can be attributed to their strong team culture, skilled players, and effective coaching.

48. Ang mga buto ng mais ay dapat na itinanim sa loob ng 1-2 pulgada sa lupa, at dapat na itinanim sa isang distansya ng mga 8-12 pulgada sa pagitan ng bawat halaman

49. Pumunta kami kahapon sa department store.

50. At blive kvinde handler også om at lære at håndtere livets udfordringer og modgang.

Recent Searches

kaarawanhigh-definitionhidingomeletterepublicaniteknologikasingledthroughhinampaswalng11pmbitiwanprincepangingimibehindideyaipapahingastatusdindoessettingstructurethreebinatangayanalintuntuninandrenatingactivityandypagkababasanggolbasketubopinakamahalagangbaboynegativepaalammontrealprotestashockguroipantaloptrabahoaksiyondeliciosarosalibongpromiseipinasyanginfluencevisualmanalopagkalungkotnapakalusogbahagyangpaosgawaumibiggaanodiagnosesadverseangkopsoftwaredinalawmag-plantlimoslumapadhoweverharmfulsponsorships,nanghihinapagkaimpaktomaglalakadnaglalakadnanghihinamadlumingoninakalangnahuhumalingnapakagagandananlilisiknaupotvslangostamagkakaroontumigilfactoresmamahalinnaglokohanpartsmahinognakakatabatravelpahahanapnaghuhumindiglondonmaintindihankaninumanlumakinaglokoiglapsaranggolapagbabantabinuksannalugodmahabangemocionestienenpatakbongpatawaringinawangalaknatalohawlatanyagmatandangpisarakasangkapanbayaningmarinigmahigpitnagniningningnuevonakasakaypaladmaatimfederalidiomalubosannikasinakainisbalinganentertainmentforskelcompositoresnatulogkayaproducts:bandamasarapiyonhomemukhaopportunitiesimageslimitedkabuhayansignhmmmmaskipakealamsumigawgagdollyknownfreebinigaymansanasattractivebelldontpulawalisresearch:cardhadhithalamanputaheperaforceslitomagtanghaliangayunmanhighdollarnaiinggitincreasinglyiosbulaabalaneedmundo2001nasundoactionoffentligbeginningpronounmahabaandroidformatbituinheftycorneruniquehimig