Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Up above the world so high

2. The task of organizing the event was quite hefty, but we managed to pull it off.

3. Ang daming adik sa aming lugar.

4. Habang kaming mga naiwan ay paglalabanan at pag-aaralang tanggapin ang kirot ng pagkalungkot.

5. Kape ang iniinom ni Armael sa umaga.

6. Isang tanod ang dumating at sinabing may dalaw si Tony

7. Ang pag-ulan ay nagpawi ng init at tuyot sa lupa.

8. At ignorere sin samvittighed kan føre til skyldfølelse og fortrydelse.

9. Samakatwid, walang makapagsabi kung saan nakatago ang gong.

10. ¿Cuánto cuesta esto?

11. Mahilig si Tatay manood ng laro kung saan ang gamit ay bola.

12. All these years, I have been grateful for the journey and excited for what the future holds.

13. Libre ba si Carol sa Martes ng gabi?

14. Naglalaway ang mga manonood habang pinapakita sa TV ang masarap na pagkain.

15. Napansin niya ang takot na takot na usa kaya't nagpasya ito na puntahan ito.

16. When we forgive, we break the cycle of resentment and anger, creating space for love, compassion, and personal growth.

17. In this industry, singers who can't write their own songs are a dime a dozen.

18. Después del nacimiento, la madre necesitará tiempo para recuperarse y descansar, mientras que el bebé necesitará atención constante y cuidado.

19. Ang mga bayani ay nagbibigay inspirasyon sa mga kabataan upang maging mabuting mamamayan.

20. They have studied English for five years.

21. Masarap at manamis-namis ang prutas.

22. Baka puwedeng hiramin mo ang iyong sasakyan para sa isang biyahe.

23. ¡Muchas gracias!

24. Isa kang hampaslupa! saad ng matapobreng babae.

25. Sa takip-silim, nagiging malamig ang panahon at nakakapagbigay ng komporta sa mga tao.

26. Umihip ang malamig na hangin, waring may paparating na masamang balita.

27. May tatlong kuwarto ang bahay namin.

28. Hindi maganda na maging sobrang matakot sa buhay dahil sa agam-agam.

29. Matapos ang isang matinding pagsubok, hindi maiwasan ang paglabas ng malalim na himutok.

30. The Great Barrier Reef in Australia is a wonder of marine life and coral formations.

31. Limitations can be addressed through education, advocacy, and policy changes.

32. Tuwing umagang mananaog siya upang umigib, pinagpapaalalahanan siya ng ina.

33. Tinangka niya itong pigilan ngunit huli na ng naabutan niya ang matanda.

34. makaraan ang ilang sandali, dahan-dahan at nanlalambot siyang tumindig, nakatuon ang mga mata kay Ogor.

35. Kumalas ako sa pagkakayakap niya sa akin.

36. Basketball is a popular sport for both men and women, with many professional women's leagues around the world.

37. Mas maganda kung tayo ay maging totoo sa ating sarili kaysa sa magpakatanga sa kababawan ng mundo.

38. Wala ho akong kinukuha sa inyong pitaka.

39. Nagtagisan ng galing ang mga maghahabi.

40. Di kalaunan, habang lumalaki ang bata, napapansin nilang ito nagiging salbahe, napakasinungaling at maramot.

41. Emphasis is an important component of artistic expression, such as in poetry and music.

42. Sa paggamit ng mga kagamitan, huwag magpabaya sa tamang pag-aalaga at pagpapanatili nito.

43. Nagkapilat ako dahil malalim ang sugat ko.

44. May klase ako sa Tagalog tuwing Lunes.

45. Umutang siya dahil wala siyang pera.

46. Sweetness can be used to mask other flavors and create a more palatable taste.

47. Bukas na pala ang araw ng kalayaan.

48. Nag merienda kana ba?

49. Kagyat na sumagot ang amang nangingitngit, ngunit siya man ay pinagwikaan din ni Aya.

50. Nous avons choisi un thème de mariage champêtre.

Recent Searches

alexanderhigh-definitionjeromewriting,1000karingseguridadsalapimedievalsofapunongkahoynagtrabahopakistanpatienceganyanhetonuevodumagundongnaligawoponagsagawanamilipitbagmatapangeffektivprobinsiyaprutasplatobatokwalngfacilitatingkulaytiketmaarawandymagpakasalnapakahusaynailigtasfotosgumagalaw-galawnapilicallerbansangpalayanasuldiagnosticeducationalmenseskuweladedicationklasepinabayaanmaidnagpakitatagalog19801982colourkasalforskel,tumahimikhverlockedkamatislikelyestudyantekamakalawasystems-diesel-runwaringbroughtmabutingaffectabut-abotelvismagagamitnakarinigfaulttipidmaayospangilmagbagopalakaydelsertuktokmagsabinakakahugisalmacenarlibanganmurailoiloscientistubodtignanhinognalalamanmanonoodorugaasotalentkagyatnapatakbopangungusapsarilipicturesmusicianbalahiboyournaabutantog,meronmagka-apoipapainitkahoysusunodnungminahanthingstahimikpinag-aralannapakamotnegativeisipinngunitbisikletaumagawnakahantadpaananisinaboynagtatrabahocnicobaranggaygeologi,graduationbatang-batatotoongactorkinauupuangtoyikinasasabikcalidadpinanoodpamanhikaniniresetabiggloriabighanidibapeppypasensiyayourself,matandangmenosrightspaghabasagasaansunud-sunodaddictionmanuelibigparticularalaytabaslasonmakapagsabiclientesnakinignasunogpapayatomarsasamahancardprofessionaloftedrenadopagkuwafulfillingminutepedroexpensesloribayangpigingsyncpagkatakotmananaigkalabaninuulamitomagitinglumitawmapadalikabilangbuhaybook,nakalagayfitnessbihirangenglandnaapektuhan