Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Waring nag-aalangan siyang pumasok sa silid dahil sa takot.

2. Pour maintenir sa motivation, il est important d'avoir des objectifs clairs et réalisables.

3. L'intelligence artificielle peut être utilisée pour prédire les résultats des élections et des événements futurs.

4. Bakit ba? Hinde ba ko pwedeng magsungit?

5. Binilhan ni Fidel ng bulaklak si Imelda.

6. Si Ma'am Luisa ay magbabakasyon sa kanilang probinsya.

7. He was hospitalized for pneumonia and was on a ventilator for several days.

8. Makikiligo siya sa shower room ng gym.

9. Puwede kang magguhit ng mga larawan ng iyong pamilya at kaibigan upang ipakita ang pagmamahal sa kanila.

10. Mathematics is a language used to describe and solve complex problems.

11. Las vacaciones son una época para compartir regalos y mostrar gratitud.

12. Muchas ciudades tienen museos de arte que exhiben obras de artistas locales e internacionales.

13. Inflation kann auch durch eine Erhöhung der Steuern verursacht werden.

14. Las escuelas tienen diferentes especializaciones, como arte, música, deportes y ciencias.

15. Einstein's theory of general relativity revolutionized our understanding of gravity and space-time.

16. Dahil sa maling pagdisiplina, naglipana ang mga pangit na gawi sa lipunan.

17. Coffee can be prepared in a variety of ways, including drip brewing, espresso, and French press.

18. Maaaring magdulot ng pangmatagalang epekto sa kalusugan at kaligtasan ng mga tao ang digmaan.

19. Si Mang Ernan naman na isang manunulat, isa ring propesor sa isang unibersidad sa maynilaat nagging kasapirin sa iba't ibang samahan

20. Limitations can be self-imposed or imposed by others.

21. It's important to be careful when ending relationships - you don't want to burn bridges with people you may encounter in the future.

22. Kailangan ng mas magandang oportunidad sa trabaho at edukasyon para sa sektor ng anak-pawis.

23. Anong ginagawa mo?! mataray pang sabi nito.

24. Ngayon lang ako nag mahal ng ganito.

25. Habang kaming mga naiwan ay paglalabanan at pag-aaralang tanggapin ang kirot ng pagkalungkot.

26. Twinkle, twinkle, little star,

27. The singer's performance was so good that it left the audience feeling euphoric.

28. Después de hacer ejercicio, me gusta darme una ducha caliente.

29. Ang mailap na mga bagay ay kailangan paglaanan ng oras at pagsisikap upang makamit.

30. Dalawa ang pinsan kong babae.

31. Les personnes âgées peuvent avoir des problèmes de communication en raison de problèmes de vue ou d'ouïe.

32. Malaki at maganda ang bahay ng kaibigan ko.

33. Kung siya ay salamangkero, bakit hindi niya ginamit ang kapangyahiran niya sa akin?

34. Nagbigay ng kanyang opinyon ang eksperto ukol kay President Bongbong Marcos

35. Ang alon sa dagat ay humihila palayo sa pampang.

36. Es importante que los gobiernos tomen medidas para ayudar a las personas pobres.

37. Mas maganda si Bingbing kaysa kay Jingjing.

38. Kasalukuyan siyang nagtitiis sa init nang may maulinigan siyang siga mula sa tindahan.

39. Les personnes âgées peuvent avoir des relations intergénérationnelles enrichissantes avec leurs petits-enfants.

40. Les crises financières peuvent avoir des répercussions importantes sur l'économie mondiale.

41. Ang pagtitiyaga sa pagbabayad ng utang ay magdudulot ng kapanatagan sa buhay at magpapalakas ng financial stability.

42. Nakalimutan kong magdala ng flashlight kaya nahirapan akong makita sa pagdidilim ng gubat.

43. Nabagalan ako sa takbo ng programa.

44. Nagpunta ako sa may lobby para magisip.

45. A couple of hours passed by as I got lost in a good book.

46. Habang daan, samantalang patungo sa pamilihang-bayan ng Tondo, ay mataman niyang iniisip ang mga bagay na kanyang pamimilhin.

47. Les personnes âgées peuvent être bénéfiques pour la société en partageant leur expérience et leur sagesse.

48. Dogs can be trained for a variety of tasks, such as therapy and service animals.

49. Napasigaw ang naghihinagpis na ina! Hindi nito maatim ang nakikitang paghihingalo ng mga anak.

50. Sang-ayon ako na importante ang pagpapahalaga sa ating kultura at tradisyon.

Recent Searches

utilizarmarmainghigh-definitionsalattaostomargearlayasandamingaccederbigotetinanggappagodreplacedtumangomedidaumiinithariputaheoutpostlorilabingmuchaslumulusobkerbspeechesbipolarnabalitaantechniquesinalalayan1787walangdoonsteercallmovingyearkilosulinganresultposterstorekailannatutuwarefulingallowsmonitorclassmatecommerceipihitpowerscornerpinagbubuksankapintasangatagilirankinasisindakankwebalendkaraokelarawanbagnagbentanagpepekepinaghihiwawaitjustine-commerce,sasakaytinulak-tulakmangingisdastorequirenapakaningningtiktok,iniresetaipagtanggolobviouspakpaksedentaryfindnakararaanmataodatanatatawanagkakatipun-tipongreatlynapakabangokutodfeedbacknooctricasluisaselltandanguminomdealkalongmelvinbagamatlunasnagniningninghistorianaglalatangtinitignanpinakamatunogmalamigwebsitebehindlefthimselfroofstocknasundokaydyosabalingangustonghelenawakaskoronapiratainferioresilawseparationnagpapantalnagpapaigibpagpapatubonakikilalangnagpapasasahubad-baromakipag-barkadanagkakakainmakakabalikvillagenagmistulangencuestasbuwenassahoddahilsiyudadsementeryotrabahopartsschedulealoknapaghatiantalinosocialesbintanasubject,computere,tarcilapresyoadditionally,gabrielbarangayjagiyabunutanmatalimminahandingpananghalianbinibilihastareynaenergydiseases10thnasantuladlagunamartialpropensobandaestablish1940kasingtigasnakatingingmasasakitproblematinikmanconcernprogramming,absmangungudngodenergiangpaamesangcoatkakataposprutaspreviouslydidingeksamkingtrackanghelincludesource