Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Dedication is the commitment and perseverance towards achieving a goal or purpose.

2. Ang kanyang bahay sa Kawit ay isa na ngayong pambansang dambana.

3. Gandahan mo ang ngiti mo mamaya.

4. Apa kabar? - How are you?

5. I know things are difficult right now, but hang in there - it will get better.

6. Naku hindi na po. Ayos lang po ako.

7. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

8. Be my girl, Jacky. bulong niya sa tenga ko.

9. Frustration can lead to impulsive or rash decision-making, which can make the situation worse.

10. I have seen that movie before.

11. Nagpapadala ako ng mga kanta at mensahe sa aking nililigawan upang ipakita ang aking pagmamahal.

12. Ang pagpapahalaga at pag-unawa ng aking mga magulang sa aking sitwasyon ay nagpawi ng aking lungkot at kalungkutan.

13. Mi sueño es convertirme en un músico famoso. (My dream is to become a famous musician.)

14. Upang makatiyak, isinama ng datu ang pinakamatapat na kawal nang dumating ang ikatlong gabi.

15. No puedo controlar las acciones de los demás, solo puedo aceptarlas con "que sera, sera."

16. Kinuha ko yung CP ko at nai-dial ang number ni Joy.

17. Ang maliit na mesa ang nasa kuwarto.

18. Lazada offers various payment options, including credit card, bank transfer, and cash on delivery.

19. Ang pagbibigay ng alay sa mga diwata ng kalikasan ay isang mahalagang ritwal sa kanilang kultura.

20. Walang pagtutol sa mga mata ng mga ito.

21. This has led to increased trade and commerce, as well as greater mobility for individuals

22. Sa loob ng zoo, pinagmamasdan niya ang mga hayop na naglalaro sa kanilang kulungan.

23. Sa mga himig ng kundiman, nadarama ang tibok ng puso at pagkakaisa ng mga Pilipino.

24. Kucing dikenal dengan sifatnya yang lucu, manja, dan lincah.

25. La vaccination est un moyen efficace de prévenir les maladies infectieuses et protéger la santé publique.

26. Lalo itong nalungkot nang malamang magdaraos ng isang handaan ang Adang kagubatan.

27. Mathematics helps develop critical thinking and problem-solving skills.

28. Det kan være svært for transkønnede personer at finde støtte og accept i deres familie og samfund.

29. Nakakatuwang malaman na maraming kabataan pa rin ang nakikinig at nakakatuklas ng kagandahan ng mga kanta ng Bukas Palad.

30. William Henry Harrison, the ninth president of the United States, served for only 31 days in 1841 before his death.

31. Anong bago?

32. The acquired assets will give the company a competitive edge.

33. Online surveys or data entry: You can earn money by completing online surveys or doing data entry work

34. Hindi ako sang-ayon sa mga kuro-kuro ng ilang mga pulitiko.

35. LeBron James is a dominant force in the NBA and has won multiple championships.

36. Protecting the environment requires a collective effort from individuals, organizations, and governments.

37. Sa bawat kumpetisyon, ipinapakita ni Carlos Yulo ang kahusayan at disiplina ng isang atletang Pilipino.

38. Ang lakas ng sagap ng wifi sa kanilang bahay.

39. Übung macht den Meister.

40. Nais ko sanang magkita tayong muli dito sa halamanang ito mamayang gabi.

41. Upang huwag nang lumaki ang gulo ay tumahimik na lang si Busyang, nagpatuloy naman sa pakikipagtagpo sa mayamang Don Segundo ang ambisyosang anak.

42. Gracias por su ayuda.

43. Ang tunay na kaibigan ay maasahan sa oras ng kagipitan.

44. La science environnementale étudie les effets de l'activité humaine sur l'environnement.

45. Menos kinse na para alas-dos.

46. Naglalaway ang mga manonood habang pinapakita sa TV ang masarap na pagkain.

47. Lazada's mobile app is popular among customers, with over 70 million downloads.

48. Siguro ay may kotse ka na ngayon.

49. Kailan niyo naman balak magpakasal?

50. Helte kan inspirere os til at tage positive handlinger i vores eget liv.

Recent Searches

high-definitionpongrosellehumigasumasakitjenapasensyaedsasaradissecompositoresfitbalatklasengkontingvivacarloorganizekarganginfluencesmakinangtibokmayabongtulangtugondespues1960ssisipainhimayinawardcalidadipagmalaakimininimizemakagawasinimulandyipindiagranadacassandranagdarasalfauxipantalopbinasamansanasmukasumagotdogssupilinopomaskimarteschoiblusanatandaanhmmmbagamatkalakihanbriefestablishjokedettecongresstelangkabibibusyangprimerterminoexcusesweetclaseshangaringreserveswordmarioespigasfuelguhitencompassestaingaseriouspopularizemahahabaitinago11pmmerrymaisgivearbejderwaribiglamapaibabawtransmitskapetillgrammarblusangadangsnasolarferrerbeeneducationalfatalcalldollarmetodeeksaytedmapadaliteamdumatingfistsspeedtuwidtwinklestatusstudentcomeshockkumarimotbelievedtransitbilisdontitinalicompartenmalinisrobotictennagreplylatestpinalutobilhinspecialcommissioncomienzanveryredesleukemiahinabanilinislegendsharingshiftcomputercomplexincludegitarahateneedsbehaviorwindowformsflashcompleteexplainberkeleytwopublishedcableipinalutoviewbasaelectedstopknowmenucommercegoingextraprovidedinteriorthoughtsonlytiyasquatteritlogdoscomputereflyactiondoonnothingcleancakeipapahingahimutokpagnagdaramdamhumihingimonghumarapadvertising,baoendviderenagsisilbikagalakanmallopdeltpagtiisanmagda