Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Ang mailap na mga bagay ay kailangan paglaanan ng oras at pagsisikap upang makamit.

2. The most famous professional basketball league is the NBA (National Basketball Association), which is based in the United States.

3. Los teléfonos inteligentes son una evolución de los teléfonos móviles y ofrecen aún más funciones y capacidades

4. Kapag nalulong ka na sa droga, mahirap nang magkamit ng kaganapan sa buhay.

5. Representatives must be knowledgeable about the legislative process, legal frameworks, and policy implications to make informed decisions.

6. Mathematical formulas and equations are used to express relationships and patterns.

7. Nahihilo ako dahil masyadong mainit ngayon.

8. Puwede bang pahiram ng isang kutsara? Nakalimutan ko ang aking sa bahay.

9. Bumalik siya sa lugar ng aksidente at tulala sa nangyari.

10. Hindi ako komportable sa mga taong nagpaplastikan dahil alam kong hindi nila ako tunay na kakampi.

11. Bien hecho.

12. Nakita ng mga ibon si Paniki at tinanong siya kung bakit siya asa kanilang kampo samantalang isa naman daw siyang mabangis na hayop.

13. Sa isang malakas na bagyo, hindi ko na nakita ang aking mga kasama dahil sa sobrang pagdidilim ng paningin ko.

14. Gusto po ba ninyong lumipat sa ibang kuwarto?

15. At tuluyang nagliwanag ang buong paligid at nawala ang dalawa.

16. Ang mga mamamayan sa mga lugar na mayaman sa tubig-ulan ay dapat mag-ingat sa pagtatapon ng basura upang maiwasan ang pagbabara ng mga daluyan ng tubig.

17. Manahimik ka na nga, tara ng umuwi! Andyan na driver ko!

18. Representatives often collaborate with other officials and stakeholders to achieve common goals and address broader societal issues.

19. My friends surprised me with a birthday cake at midnight.

20. Sang ayon si Jose sa suhestiyon ng kanyang kaibigan.

21. Bumili si Ana ng regalo para diyan.

22. Isa daw siyang mabangis na hayop dahil tulad nila meron din siyang matatalim na mga pangil.

23. Kapag mayroong sira sa ngipin, kailangan ng agarang aksyon upang hindi lumala pa ang problema.

24. Natutuwa ako kapag nakakakita ako ng isang halamanang mayabong sa mga pampublikong lugar.

25. Pagkatapos ay abut-abot ang kanyang paghingi ng paumanhin sa mga duwende.

26. She admires her mentor's leadership skills and work ethic.

27. Kung ako si Maico? Malamang magwawala ako. aniya.

28. Mahilig sya manood ng mga tutorials sa youtube.

29. Sa ganang iyo, sapat na ba ang ginawa niya upang maitama ang kanyang pagkakamali?

30. Hindi siya naging maramot nang magbigay ng kanyang oras para tumulong sa proyekto.

31. Inflation kann sowohl kurz- als auch langfristige Auswirkungen auf die Wirtschaft haben.

32. Pupunta ako sa Madrid sa tag-araw.

33. Pinking shears are scissors with zigzag-shaped blades used for cutting fabric to prevent fraying.

34. Let's just hope na magwork out itong idea ni Memo.

35. Waring nag-aalangan siyang pumasok sa silid dahil sa takot.

36. An omelette is a dish made from beaten eggs cooked in a pan.

37. Sa pamamagitan ng kundiman, naipapahayag ang mga hindi nasasabi ngunit nararamdaman ng mga pusong sugatan.

38. Mange små og mellemstore virksomheder i Danmark eksporterer varer og tjenester.

39. Lumapit ang mga tao kay Ana at humingi ng tawad sa kaniya sa pagiging marahas ng mga ito.

40. Malamig na pawis ang gumigiti sa kanyang noo at ang tuhod niya ay parang nangangalog.

41. Ang dami daw buwaya sa kongreso.

42. Tumango lang ako. Wala ako sa mood na magsalita.

43. Hindi nawawala ang halaga ng panitikan sa pagpapalaganap ng kultura at kaalaman, kaya't ito ay mahalaga sa buhay ng mga tao.

44. Microscope lenses must be kept clean and free of debris to avoid distortion and other imaging problems.

45. Ang mga pangarap natin ay nagbibigay sa atin ng inspirasyon upang magtrabaho nang husto.

46. La pobreza es un problema que afecta a millones de personas en todo el mundo.

47. Walang bagay na di makita at agad tinatanong ang kanyang ina.

48. May nakita akong matandang nag-aalok ng pulotgata sa palengke.

49. Dahil sa sipag at determinasyon, nakamit ni Michael ang tagumpay.

50. Cocinar en casa con ingredientes frescos es una forma fácil de comer más saludable.

Recent Searches

interests,high-definitionngatumawaniyansumamaorugawashingtonnaglokonamulatpalipat-lipatsportsorkidyasydelserasalplanning,karaniwangcontestsinehanideamisusedoffentligdulakagayamagturonaliligoarbularyonakumbinsikarwahengsalaminafternoonminatamiskasamaangmamayamarvinipinambilirewardinguloself-defensenetflixanywheredevelopmentatingyongipakitapisopanghabambuhayusemagkakaroongumisingkapeteryahulidibisyonactualidadsumasambaalammag-anaknaglalatangprinsesafewsittingkinaaggressionnatapospumasoksamang-paladnicolayout,capacidadesayantanongtsismosaochandonatalongnagbibigayancadenapagkakatayobagayfurkawili-wiliisinakripisyolossumalakaymedicalglobalrobindissekamiandyaalissamantalangmorepamilyanagtutulakendviderekumidlatendeliggranadaengkantadaparaaksidenteplagueddyandumaramiparatingnapakagagandataascruzblendoktubremaghapongnagawangmiyerkolesbilangmariangisulatiintayincardiganbehaviorunidosgubatnangangalittabingaltpagsasayaanongkaysanag-aagawanrepublicansatinbagamatumulanisdadiliginkainanaddictioncnicosandaliconflaviolinawbulakpataycoachingtiniopropensoknow-howmaaringtahimiknamungaexpertspeechimposiblepumitasnakabulagtangdoublehulyoginagawaabanganerrors,basakasingsiyanamataytsuperinvestnakalipasngunitpublishingdaanbumuhossabadongalingnakatingalafar-reachingnaroonlibangannauntognag-aaralkambingbakasyonbecamenanaogpinakamahalagangkasiyahanmateryaleskapemournedtwitchphysicalnakaupokanikanilangpagtinginospitaltinigrosasmagtatapostumunogninanaisfactores