Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Ada udang di balik batu.

2. Binuksan ko ito at binasa yung nakalagay.

3. Smoking during pregnancy can harm the fetus and increase the risk of complications during pregnancy and childbirth.

4. Naglipana ang mga ibon sa hardin ngayong tag-araw.

5. Ang paglapastangan sa ating mga tradisyon at kultura ay isang pagkawala ng ating pagkakakilanlan.

6. Sa pagkain ng pulotgata, mahalaga na maghugas ng kamay upang hindi magkalat ang tamis sa ibang bagay.

7. Maraming aklat ang naisulat tungkol kay Apolinario Mabini at ang kanyang kontribusyon sa kasaysayan ng Pilipinas.

8. Sang-ayon ako sa opinyon mo tungkol sa pagsasama ng magkaibang relihiyon.

9. Hospitalization can be expensive, and patients may be responsible for paying for medical bills and other associated costs.

10. The cake you made was absolutely delicious.

11. The United States has a long-standing relationship with many countries around the world, including allies such as Canada and the United Kingdom.

12. She decorated the cake with colorful sprinkles and frosting.

13. Sa gitna ng mga problema sa trabaho, hindi maiwasang ikalungkot niya ang kakulangan ng suporta mula sa kanyang boss.

14. Hun er en af ​​de smukkeste kvinder, jeg nogensinde har set. (She is one of the most beautiful women I have ever seen.)

15. Mahalagang maging totoo sa ating mga sarili at sa mga taong nakapaligid sa atin, datapapwat ay may mga pagkakataon na tinatago natin ang ating mga tunay na damdamin.

16. Las hojas de los cactus son muy resistentes y difíciles de cortar.

17. Pagkatapos ay abut-abot ang kanyang paghingi ng paumanhin sa mga duwende.

18. The song went viral on TikTok, with millions of users creating their own videos to it.

19. Bakit mo siya binilhan ng kurbata?

20. Hindi ka nag-iisa, mayroon kang kaulayaw na handang tumulong sa iyo.

21. Las pinceladas sueltas y rápidas le dan a la pintura un aspecto más dinámico.

22. Ok lang ba to? Baka naman magalit si Abi.

23. Ang pasaway na estudyante ay na-suway nang paulit-ulit ng kanyang guro.

24. At blive kvinde kan også være en tid med forvirring og usikkerhed.

25. Las labradoras son una raza de perros muy populares en todo el mundo.

26. Lumibot siya sa buong paligid ng ospital upang alamin ang mga pasilidad na maaaring magamit ng kanilang pasyente.

27. Ang pagsasama ng pamilya ay isang nakagagamot na karanasan na nagbibigay ng tunay na kaligayahan.

28. En invierno, la ropa de invierno, como los abrigos y las botas, está en alta demanda.

29. Anong pagkain ang inorder mo?

30. The internet, in particular, has had a profound impact on society, connecting people from all over the world and facilitating the sharing of information and ideas

31. Igigiit nito na ang matanda ay nandaya at baka ipinalit lamang ang isang nagawa nang tela sa ginagawa nito.

32. Hindi natin maaaring iwan ang ating bayan.

33. Nakapagsasakay ang dyipni ng 16 na pasahero.

34. Mataman niyang inisip kung may iba pang nakakita sa nangyari.

35. Ang may-akda ay nagsusulat ng libro upang ibahagi ang kaniyang kaalaman at karanasan.

36. Sa muling pagtuturo ng relihiyon, natutunan ng mga bata ang konsepto ng purgatoryo.

37. He was advised to avoid contact with people who had pneumonia to reduce his risk of infection.

38. Gusto pa niyang magbalik sa sulok na kanyang higaan.

39. How I wonder what you are.

40. Kapag mayroong mga proyektong mahirap, pinagsisikapan ng mga manggagawa na matapos ito ng maayos.

41. The depth of grief felt after losing a loved one is immeasurable.

42. Este año espero cosechar una buena cantidad de tomates de mi huerto.

43. They do not litter in public places.

44. Ang presidente ng Pilipinas ay nagpabot na ng ayuda sa mga mahihirap.

45. Napunit ang papel ng saranggola dahil sa malakas na hangin.

46. Ano ang ginagawa mo nang lumindol?

47. Sumimangot siya bigla. Hinde ako magpapapagod.. Pramis.

48. Dette skyldes, at den offentlige regulering sikrer, at der er en vis grad af social retfærdighed i økonomien, mens den frie markedsøkonomi sikrer, at der er incitamenter til at skabe vækst og innovation

49. Sa lugar na ito, naglipana ang mga prutas na hindi pangkaraniwan sa ibang lugar.

50. Bakit sila makikikain sa bahay niya?

Recent Searches

high-definitionphilippineeneroitinagomarmaingblusaalaymeronmagisingpumilihopedalawapancitilaninomnunotuwangcupidinantoksilbingsubalitduonbranchpiecessumarapcafeterialumuwasbinigyangpumuntabugtongpingganipagamotrhythmzoombook:soreipagbiliseeksatisfactioninalalayanbilertripinalokminutepasangcomplicatedroseisaoncemagbungaanimomapadalistudentsconectannamesurgeryheikilolangspaposterballpeterbowsquattercalldinalacandidateinspiredworkdayareaetohalikanaiinggitgenerateyeahemphasizedpublishedipinalitsupportincreasesstyrerdifferentmultonutscablecontinuedreleasedtahimikmakapilingprocessknowledgeformsdevelopmentmemorycontinueevolvedtableexistwaitnaka-smirkagadpagkainmariahigitnapabuntong-hiningapagkataomag-asawangdapit-haponpumapaligidtumatanglawcultureunattendedtemparaturamensaheadgangisinuottahanantungkodmarketing:kumampinavigationmaghatinggabitotookamaliansinapokewanrepublicanmaglabapalapagtabimadulasskypekingdomestateituturocalciumkagandamakasarilingtodaymaskprimeripipilitreservationnamingsumagotleedivideswaysenterreadingpaidfredkasingheftyimprovedumaagosstoppinagalitanrobertriyantuloyposporonegro-slavesnawalangpaglalayagkaliwapagkaawanagmistulangpinansintrentaika-12pamumunoadvancementnagpasamalever,gawaingmerchandisepulangmabutinglandasbihirasurveysbutasprobinsyadumilatngisimaghahandaganangnapilitanginagawakatapatpakisabirabbanahihiloalinibinentapalibhasakindskatedral