Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. The victim was relieved to finally have closure after the culprit behind the crime was caught and prosecuted.

2. Nabangga ang kotse ni Juan bandang alas-tress ng hapon.

3. Sa tuwing Undas, bumibisita ang mga pamilya sa sementeryo upang mag-alay ng mga dasal para sa mga yumaong kamag-anak na maaring nasa purgatoryo pa.

4. She learns new recipes from her grandmother.

5. Ang lalaki ng isdang nahuli ni itay.

6. Los héroes defienden la justicia y luchan por los derechos de los demás.

7. The invention of the telephone led to the creation of the first radio dramas and comedies

8. Kulay pula ang libro ni Juan.

9. Napakabuti nyang kaibigan.

10. Nasa ilalim ng silya ang payong ko.

11. Scientific research has shown that regular exercise can improve heart health.

12. Nous avons invité tous nos amis et notre famille à notre mariage.

13. Lumakad ako nang mag-isa sa madilim na daan at nagitla ako nang biglang may humawak sa aking balikat.

14. Kami ay pabalik na diyan sa kaharian, pasensiya na sa masamang balita.

15. Algunas heridas pueden requerir de cirugía para su reparación, como en el caso de heridas graves en órganos internos.

16. La menta es una hierba refrescante que se utiliza en bebidas y postres.

17. Mga ganid sa kapangyarihan ang ilan sa mga pulitiko.

18. La realidad nos enseña lecciones importantes.

19. Nag toothbrush na ako kanina.

20. Pumasok po kayo sa loob ng bahay.

21. Una dieta equilibrada y saludable puede ayudar a prevenir enfermedades crónicas.

22. They have organized a charity event.

23. Kumakain ng tanghalian sa restawran

24. Kumaripas ng uwi si Pedro matapos niyang marinig ang masamang balita.

25. Workplace culture and values can have a significant impact on job satisfaction and employee retention.

26. Kahit hindi siya lumingon, para na niyang nakita si Ogor.

27. Los héroes son fuentes de esperanza y fortaleza en tiempos difíciles.

28. Dedication to personal growth involves continuous learning and self-improvement.

29. Television has also had a profound impact on advertising

30. Siya ang aking kaulayaw sa lahat ng bagay.

31. She is designing a new website.

32. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

33. Ano ang gusto mong gawin kapag walang pasok?

34. No puedo dejar de dar las gracias por todo lo que has hecho por mí.

35. Tumatawa pa siya saka pumikit ulit.

36. Ang pagkakahuli sa salarin ay nagdulot ng kaluwagan sa mga biktima at kanilang pamilya.

37. D'you know what time it might be?

38. Sila ang unang angkan ng mga aso sa daigdig.

39. Nag hiking kami sa Mt. Makiling.

40. Bell's telephone consisted of a transmitter, which converted sound into electrical signals, and a receiver, which converted the signals back into sound

41. Sabi ko sa inyo, halos kumpleto kami kasi wala si Sync.

42. Ewan ko sayo, ikaw pinakamaarteng lalakeng nakilala ko.

43. He used TikTok to raise awareness about a social cause and mobilize support.

44. Los océanos contienen la mayor cantidad de agua en la Tierra.

45. Ang palay ay hindi bumubukadkad kung walang alon.

46. Ano ang ginawa mo kagabi bago ka matulog?

47. They offer rewards and cashback programs for using their credit card.

48. El arte contemporáneo es una forma de arte que refleja las tendencias y estilos actuales.

49. The transmitter and receiver were connected by a network of wires, which allowed the signals to be transmitted over long distances

50. Mamaya na lang ako iigib uli.

Recent Searches

lumilipadhigh-definitionmakausapnapakamisteryosokaloobangpresidentialadvertisingipinamilinakuhanakapagsabipinangalanangsabongnoonmataaasngipinenvironmentglobalnahantadcallambaghoneymoonmag-anaklastisinaboyiskedyulnapaluhaburmapoonmatangkadflyvemaskinerlondontherapytinawagpambatango-orderxviimapdebatesninyongnagpalalimmasaksihanwakasmeetingnagsisipag-uwiannanahimikmagisingtagaytaymasaholbinasamapayapakumirotpreskomataraykaparehanitongumokaysamuusuariobusogseniorentrybugtongwalamultahimikgayunpamanalikabukintinangkausopinagbigyannahintakutannakauwikaninongiyoumiyakubobinabaratmagsasakanakaangatkamiganungayunmanlangevenmerchandisepagkagustomisteryonakipagnapakabilismagsainguniversitytutoringnanggigimalmalnangingitngithayaanentrereviewkampeonmainitlitonagsusulatkakaantaypinasalamatansumakitexcitedrepresentedkumalmamadulasnatanggapmusicsuloklastingjulietaltkapataganarmedfacebooksubaliti-rechargewondermagsusuotilalimnakangitiheymonumentoestablishkailandiseasesumiisodpinakabatanghousepinakamatabangnakikilalangdalawangnariyanginagawapagkakatayoisiplackitemslabahindeletingstartedwalkie-talkietelebisyonalanganburgerlumbaysilbingtopicnakapagngangalitmagkasintahanbarcelonatinulak-tulakweredesign,ganyanleksiyonniyanlayawnakarinigmaligayarenacentistamaliksimalapalasyonakaraanracialdyipniawitinnagawangshadespinakamatapatawtoritadongmagpapaligoyligoypotaenaartistabibisitafarmgratificante,sikre,magkikitacountrytransportngunitkinsepalayhopetawangayoantokhalikabumitawaga-agapinanawanbatitsekinantabakaahaspalaka