Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. If you want to secure a good seat at the concert, you have to arrive early - the early bird gets the worm.

2. My favorite restaurant is expensive, so I only eat there once in a blue moon as a special treat.

3. I fell for an April Fool's joke on social media this year - a friend posted a fake news article that was so convincing I thought it was real.

4. Nationalism can also lead to a sense of superiority over other nations and peoples.

5. Sinadyang hindi magsuot ng mahal na damit si Juan sa kanyang pamamamanhikan upang magkaruon ng mas malamig na pakiramdam.

6. Bilang paglilinaw, ang pagsasanay ay para sa lahat ng empleyado, hindi lang sa bagong hire.

7. Ang daming pusa sa bahay nila Jocelyn.

8. Break a leg

9. Kakain ako ng spaghetti mamayang gabi.

10. Hindi ako komportable sa mga taong nagpaplastikan dahil alam kong hindi nila ako tunay na kakampi.

11. Maghapon nang nag computer ang kanyang anak.

12. Mas pinapaboran ko ang pulotgata kaysa sa kendi kapag gusto ko ng matamis na panghimagas.

13. Ha? Ano yung last na sinabi mo? May binulong ka eh.

14. Ang talambuhay ni Juan Luna ay nagpapakita ng kanyang husay at kagalingan bilang isang pintor.

15. Ang pagpapatingin sa dentista ay hindi lamang para sa kalusugan ng ngipin, kundi para na rin sa kabuuan ng kalusugan ng katawan.

16. Hindi ko maintindihan kung bakit kailangan pang magmangiyak-ngiyak dahil sa mga simpleng bagay.

17. Ibinigay ko ang aking panalangin at dasal para sa mga nangangailangan ng tulong.

18. Inflation bezieht sich auf die allgemeine Erhöhung der Preise für Waren und Dienstleistungen.

19. The acquired assets will help us expand our market share.

20. Buwan ngayon ng pag-aani kaya si Mang Pedro at ang iba pang mga kalakihan ay nagtungo sa bukod para anihin ang mga pananim nila.

21. Isang araw, tinikman ni Datu Duri ang isang hinog na bunga.

22. Emphasis can be used to create a memorable and impactful message.

23. Los sueños son el motor que nos impulsa a lograr nuestras metas. (Dreams are the engine that drives us to achieve our goals.)

24. Bawal magpakalat ng basura sa kalsada dahil ito ay maaaring makasira sa kalikasan.

25. Ang masamang balita ay unti-unting naghatid ng kanyang damdamin palayo sa kasiyahan.

26. Some people are allergic to pet dander and should take this into consideration before adopting a pet.

27. Saan itinatag ang La Liga Filipina?

28. She is not drawing a picture at this moment.

29. Gusto ko pumunta, pero pagod na ako.

30. Da Vinci tenía una gran curiosidad por la naturaleza y la ciencia.

31. Inilabas ng pulisya ang larawan ng salarin upang matulungan ang mga sibilyan na makakilala sa kanya.

32. Paano mo pinaghandaan ang eksamen mo?

33. Le travail est une partie importante de la vie adulte.

34. Ang mga turista ay madalas magdala ng mapa para hindi maligaw.

35. Ang pag-awit ng mga kanta at pagtugtog ng tradisyunal na musika ay bahagi ng pagdiriwang ng Chinese New Year.

36. Kung minsan, akala ng mga tao, masungit siya.

37. Matutulog ako mamayang alas-dose.

38. Ikaw nga ang dumukot ng pitaka ko at wala nang iba.

39. Walang ano-ano ay lumipad at nakita ni Perla ito na pumunta sa halamanan at nagpalipat lipat sa mga bulaklak.

40. Hindi ko kayang gawin yun sa bestfriend ko.

41. Ang tubig-ulan ay mahalaga sa pagpapanatili ng kalikasan at pangkabuhayan ng mga tao, kaya't mahalaga na ingatan at pangalaga

42. Samantala sa meeting, nagbibigay siya ng kanyang opinyon ukol sa proyekto.

43. Ignorar nuestra conciencia puede hacernos sentir aislados y desconectados de los demás.

44. Hinde sa ayaw ko.. hinde ko lang kaya..

45. Sama ako. inulit nya lang ang sinabi nya.

46. Many celebrities and public figures have joined TikTok to connect with their fans in a more personal way.

47. Ang pagiging maramot ay salungat sa pagiging bukas-palad.

48. It's a piece of cake

49. At sa kanyang paglayas, naligaw siya sa gubat at inatake ng maraming alamid.

50. Pagod na ako at nagugutom siya.

Recent Searches

high-definitionsinematabangsarasumingitpinagmariamahahanaynanlilisiknasasabihanlabing-siyampapagalitankatawangpintonakakaalamilingisuotdevelopvancontrolapuntapointcasestiniradorhinagud-hagodobservererpagsasalitanagliliyabbagyonakatirangnatawaopisinapaki-chargemahahalikbulaklaknagliwanaguugud-ugodnagtalagaclimbedsakristanmagdaraosumiyaktumikimasignaturakatutubomagsugalpagsagotmagseloshayopbinentahanpakiramdamnalugodevolucionadointerests,presentinabotpisaravaledictorianmaluwagika-50magisippadalasalaknaissellingandoymaalwangsisipainmabutibawatdispositivosamerikalapitancarolalexandersnamartesleadingtrenisilangmalumbaylokohinsquashsparepagkokakperomundoideasnathanschoolsunderholderkatabingveryfakeisugaorugamagpuntareservesusoestarnasabingipinahimactingellengamessabieveningreservedemailtumaliwassulokdanzainferioresfoundelectronicginugunitatangeksrizalbahagyangmanonoodmakapalagoutlinesdiagnosesdi-kalayuanamendmentsmaglinisnapalitangnapakalusogstyrerrightsnagsilabasangrinshubadhapag-kainandinalawlimosbedsnaglokoitinuringinfluencemonitoreitherhatesimplengipongprotestaboyarmedbakemanamis-namismakikitapagka-maktolkumembut-kembotgatherdersagutinpaghahabikamakailangumagamitmahihirappinaghatidannakuhapagdukwangnagsunurannagkwentonagtatanongnakakagalasalenapakatalinonamulatmismosubject,nagdalanangapatdanmagamotvaccinesinuulamsasakaynatitirangbagamatmenslalohinagisawitannatatanawkuligligadecuadomariesayawanlayuankamalayancompletamentekaraniwangpakibigayrieganataposbalangkombinationtelefon