Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Madalas akong matulog sa silid-aralan dahil boring ang paksa.

2. Patients may need to undergo tests, procedures, or surgeries during hospitalization to diagnose and treat their condition.

3. Makikipag-dueto si Maria kay Juan.

4. Pede bang itanong kung anong oras na?

5. Sleeping Beauty is a princess cursed to sleep for a hundred years until true love's kiss awakens her.

6. Hindi niya sinunod ang payo ng doktor, samakatuwid, lumala ang kanyang karamdaman.

7. Nangahas si Pedro na magnegosyo kahit walang sapat na puhunan.

8. Bilang paglilinaw, hindi mandatory ang pagsali sa aktibidad na ito.

9. Kapag nalulong ka na sa droga, mahirap nang magkamit ng kaganapan sa buhay.

10. Kailangang salatin mo ang tela para malaman kung gaano ito kalambot.

11. Naging mayaman din ang mag-anak dahil sa mga bentang tela na ginagawa ng bata.

12. Anong kailangan mo? pabalang kong tanong.

13. The foundation's charitable efforts have improved the lives of many underprivileged children.

14. Nagtayo ng scholarship fund si Carlos Yulo para sa mga batang gustong mag-aral ng gymnastics.

15. Hindi maganda ang amoy ng damit kung hindi ito maayos na naglalaba.

16. Kailangan ng sapat na pagpaplano upang maipon ang sapat na pera upang mabayaran ang utang sa tamang panahon.

17. Nanalo siya sa song-writing contest.

18. Elektronik er en vigtig del af vores moderne livsstil.

19. Magdidisko kami sa makalawa ng gabi.

20. Ang sugal ay isang hindi wastong paraan ng paghahabol ng pera at tagumpay.

21. Einstein was known for his sense of humor and his love of sailing.

22. Isa daw siyang mabangis na hayop dahil tulad nila meron din siyang matatalim na mga pangil.

23. This allows students to take classes from anywhere, and it also allows for the creation of specialized programs and courses that would not be possible in a traditional classroom setting

24. Ilan ang mga puno sa bakuran ninyo?

25. La paciencia es necesaria para tomar decisiones importantes.

26. Oscilloscopes can be connected to a computer or network for data logging, remote control, and analysis.

27. Napakagandang dalaga, wika niya sa sarili at tuloy-tuloy na nilapitan niya ito.

28. Kayo ang may kasalanan kung bakit nagkaganito ang buhok ko!

29. He is not watching a movie tonight.

30. Ang bagal mo naman kumilos.

31. Maraming hindi sumunod sa health protocols, samakatuwid, mabilis kumalat ang sakit.

32. Algunas personas disfrutan creando música electrónica y mezclando sonidos para crear nuevas canciones.

33.

34. Jeg har fået meget værdifuld erfaring gennem min karriere.

35. Gabi na po pala.

36. He blew out the candles on his birthday cake and made a wish.

37. Ayaw niya ng mga maarteng bagay kaya hindi siya mahilig sa mga mamahaling gamit.

38. At tilgive os selv og andre kan være afgørende for at have en sund samvittighed.

39. Ang paggamit ng droga ay hindi lamang masama sa katawan, kundi pati na rin sa isipan.

40. Instagram is a popular social media platform that allows users to share photos and videos.

41. Lahat ay nakatingin sa kanya.

42. Hindi ko alam kung sino ang unang naisip na bigyan ng pangalan ng Bukas Palad ang kanilang grupo ng musika, ngunit ito ay tunay na nakakainspire.

43. En España, el Día de San Valentín se celebra de manera similar al resto del mundo.

44. Tanah Lot di Bali adalah sebuah pura Hindu yang terletak di atas karang dan menawarkan pemandangan laut yang indah.

45. Research and analysis are important factors to consider when making investment decisions.

46. Hindi naman yan iniisip eh! Pinapakiramdaman!

47. Kailangan ko munang magpahinga para mawala ang inis ko.

48. Online business: You can start your own online business, such as dropshipping, e-commerce, or software development

49. Ang bansa ay hindi lamang sa mga nasa posisyon, kundi sa bawat isa.

50. The charity made a hefty donation to the cause, helping to make a real difference in people's lives.

Recent Searches

high-definitionenviarnalasinghate1000industriyatekstinterests,musicalesnakakitaentresocialegayundinmangyariusacommercialmobilebelievedkadalaspakakasalanipinamilieveningpiecesbaku-bakongnakapagsabitalaganginatakenegosyantemarasiganmakapagsabibreakpaghalakhakgearpesomatitigasnagsunurancosechar,sundhedspleje,diettiniknahulaanrailwaysparkingsquashipinabalikaudiencenatandaantindapaumanhindancetaksipakibigyantapatpromotetsssbeyondmalakastanawidiomaotroalagainnovationchoimalasutlaattractivesabihinibinaonaltreachdependwakasumiiyakmagpagupitpagsumamobinigayespecializadasdatieksportennangangahoystarbumaligtad1929makaiponlangdreampagtitiponnakataaspalagiinferioreskainngipingpinapakingganvidtstraktginawakangitanbackpacklagnatgisinggosharegladotandangklasrumyondefinitivobaldeginoongpagka-maktolnabubuhayiigibsamaprotestalabinsiyamwidespreadmakapalagkalimutanmatapangna-suwaymaalwangsuccesspanginoongaskalakingayonnatinagnathankinahuhumalingankahilinganconsiderarpakialampananghalianpuntahantanimanboholmakulitlumakingmag-anakmulimasayang-masayangbinitiwanfacultyharap-harapangpinipisilumutangkurakotpasigawheyfireworksfauxsteamshipsnakakapuntanagpapasasaisinalaysaymadalasalanganratefurtheramongplantasnagtuturolatesthintuturoroquecalambareynapagbigyannamalagisentenceshortideasiniibigsumingitskillquarantinedamdaminmasaksihanmagbayadhoneymoonsumaligownbinatakpakisabimabutirolebookssinatinayniyanportradekagandahanhayaanggobernadordurantenami-misspinangalanangjanelabingkumainhiniritdumi