Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Ang pag-aaral ng tao ay hindi lamang sa labas kundi pati sa kaibuturan ng kanyang pagkatao.

2. Eating fresh, unprocessed foods can help reduce the risk of heart disease and diabetes.

3. Hindi ko naiintindihan kung bakit nila gustong gawin ito kaya ako ay tumututol.

4. Cryptocurrency is still a relatively new and evolving technology with many unknowns and risks.

5. Amazon offers a wide range of products and services, including electronics, clothing, books, music, and more.

6. Eine schlechte Gewissensentscheidung kann zu Konflikten und Schwierigkeiten führen.

7. Anong pangalan niya? Maganda siya ha.

8. It has revolutionized the way we communicate and has played a crucial role in shaping modern society

9. Environmental protection can also have economic benefits, such as creating jobs in sustainable industries.

10. Pupunta kami sa Laguna sa makalawa.

11. La serpiente de coral es conocida por sus llamativos colores y patrones, pero también es altamente venenosa.

12. Kung minsan, akala ng mga tao, masungit siya.

13. They have planted a vegetable garden.

14. Bawat galaw mo tinitignan nila.

15. No pain, no gain

16. Investing in the stock market can be risky if you don’t do your research.

17. "Every dog has its day."

18. Kapag ang puno ay matanda na, sa bunga mo makikilala.

19. Uminom siya ng maraming tubig upang iwasan ang bungang-araw.

20. The weatherman said it would be a light shower, but it's definitely more like it's raining cats and dogs.

21. Einstein developed the theory of special relativity while working as a patent clerk in Bern, Switzerland.

22. Hun er utrolig smuk. (She is incredibly beautiful.)

23. Ang aming angkan ay may malaking bahagi ng kasaysayan ng aming bayan.

24. Tumango lang ako at ngumiwi, Oo eh, hindi kasi ako sanay.

25. Durante las vacaciones de Semana Santa, asistimos a procesiones religiosas.

26. El proceso de dar a luz requiere fortaleza y valentía por parte de la madre.

27. Bilang paglilinaw, ang pondo para sa event ay galing sa donasyon, hindi mula sa pondo ng paaralan.

28. Ipinagmamalaki ko ang pagiging Pinoy dahil sa mayamang kasaysayan ng ating bansa.

29. Matagal na yan. Hinde ko lang nabigay sayo.

30. Malapit na ang pyesta sa amin.

31. Nagtatanong ako sa kanya kung ano ang mga gusto niya upang masiguro na magugustuhan niya ang aking mga regalo.

32. Walang puno ang hindi hitik sa bunga.

33. The momentum of the athlete propelled him across the finish line.

34. La contaminación del agua es un problema grave que afecta la calidad y disponibilidad del agua.

35. El sismo produjo una gran destrucción en la ciudad y causó muchas muertes.

36. Hindi na kasya sa silid-aralan ang mga libro kaya nagpasya ang paaralan na magkaroon ng bagong library.

37. Musk has faced criticism over the safety of his companies' products, such as Tesla's Autopilot system.

38. Einstein was a pacifist and spoke out against war and violence throughout his life.

39. Hindi naman halatang type mo yan noh?

40. I've been driving on this road for an hour, and so far so good.

41. This has led to a rise in remote work and a shift towards a more flexible, digital economy

42. Read books on writing and publishing, it will help you to gain knowledge on the process and best practices

43. She started a TikTok account to showcase her art and gain more exposure.

44. The telephone has also played an important role in politics, as it has made it possible for leaders to communicate quickly and easily

45. Pagkatapos kong maglaba ay pupunta na ako sa mall.

46. Les jeux peuvent également dépendre de la chance, de la compétence ou d'une combinaison des deux.

47. Protecting the environment can also improve public health by reducing exposure to harmful pollutants and chemicals.

48. Pasasaan ba't di iikli ang pila? naisip niya.

49. Magkano ang arkila ng bisikleta?

50. Paano magluto ng adobo si Tinay?

Recent Searches

disposallinawhappenednatalonghigh-definitiontodaylargerjanetools,videounderholderimportantespootmasdanlabormegetwalislawscivilizationbarnesartsulamsatisfactionbilerpupuntatabassurgeryfuncionarbrideprobablementeflexiblemuchoslarrybabaedaanditocigarettesmarsofreelancerbillexpertisenarininghimiginspiredchecksuminomoffentligamingfarstageeksamhatinglorenainterpretingbulsadecisionstruerolledkalarogitaraablebehaviortutorialspublishedoftenclockcompletestringconvertingbilingmakesgoingclassmatesupportworkingspreadnatuwapagkagisingtumamanapasobrasamang-paladparaanmakauuwitaingafigurasdaramdaminnapipilitannakaisinusuotmagawapanatagpinaulanannakapanghihinakahitchildrenreachtanimsyayanshowbaleheysinasallackpyestaadvancedillegalipaliwanageveningkararatingbabainvestingpocakapasyahanpinatiralumusobantoniotinaynagbentanakabiligumisingnahihiyangkonekescuelashinding-hindilawanakakapuntamediumpinoyteleponomightcharismaticsasamastojolibeelateetsymangingisdacommunicationsnagpakitalimangpakikipagtagpopodcasts,magkakaanaksponsorships,1970spuwedengmakikitamagbayadhumahangoskumikinigpumapaligidnamumukod-tangierhvervslivetbuung-buotumahimiknagkasunogfollowing,magnakawpapanhiksasayawinnangangahoymakikipaglaroreserbasyonpagkakalutokakapanoodsumisidibinalitangkumakainartistnakasakittv-showslumakasyakapinmakakabalikpaglapastanganmagsusuotmahiwagamahinangtinakasanlalakinagkasakitnapagtantopagkasabikumalmamorningnanlalamigpangyayarinagdiretsopakikipagbabagpagtutolmagtiwalatinutoppahahanapmagsi-skiingtumagalmakalipassaritanakadapa