Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Tinuro ng coach kung paano kontrolin ang bola habang tumatakbo.

2. Isang mahahalagang pag-uusap o tagpo ang naganap sa loob ng kabanata, na nagbibigay ng bagong pag-unawa sa mga karakter.

3. Nagsagawa ng seminar ukol kay Marites sa pangangalaga niya ng kalikasan.

4. The development of vaccines and antibiotics has greatly reduced the incidence of infectious diseases, while the use of medical imaging and diagnostic tools has improved the accuracy and speed of diagnoses

5. Mabibingi ka sa ingay ng kulog.

6. Sinuspinde ng pulisya ang operasyon sa paghuli ng salarin dahil sa kakulangan ng ebidensiya.

7. Sa mga lugar na madalas tamaan ng buhawi, ang mga pamahalaan at mga organisasyon ay kailangang magkaroon ng mga programa para sa risk reduction at disaster preparedness.

8. Dahil sa pagkabigla ay hindi na nakapagsalita ang binata at ito ay napaluha na lang.

9. El cultivo hidropónico permite el crecimiento de plantas sin utilizar suelo.

10. Einstein was born in Ulm, Germany in 1879 and later emigrated to the United States during World War II.

11. Athena. nagulat siya at bigla niyang pinatay yung monitor.

12. Ang mabuti ho yata, e dalhin na natin iyan kung dadalhin.

13. Nanonood nga muna ito at saka lang bumaba sa nananalong grupo.

14. But in most cases, TV watching is a passive thing.

15. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

16. Siya ay maramot sa pagbibigay ng tulong kahit marami siyang pera.

17. Nagpasensiya na lang si Aling Rosa, napagsilbihan naman siya kahit paano ng anak.

18. La tos crónica puede ser un síntoma de enfermedades como la bronquitis crónica y la enfermedad pulmonar obstructiva crónica (EPOC).

19. Hindi ako sang-ayon sa mga patakaran na ipinatutupad ng gobyerno.

20. As the eggs cook, they are gently folded and flipped to create a folded or rolled shape.

21. Ayam goreng adalah ayam yang digoreng dengan bumbu khas Indonesia hingga renyah.

22. Hindi nakakatuwa ang mga taong nagpaplastikan dahil hindi nila nilalabas ang totoong nararamdaman nila.

23. Mahilig ang mga Pinoy sa masasarap na pagkain tulad ng adobo at sinigang.

24. The child was too young to receive the pneumonia vaccine and needed to be protected from exposure.

25. Ang mga palaisipan ay maaaring magpakita ng mga patlang sa kaalaman at kasanayan ng isang indibidwal.

26. Palibhasa ay madalas na nagsusulong ng mga bagong ideya at mga panukala dahil sa kanyang malawak na pananaw.

27. Tumawa siya. Thank you Jackz! See ya! Bye! Mwuaaahh!!

28. Sa gitna ng kaguluhan, hindi niya mapigilang maging tulala.

29. Ang pagmamalabis sa pagbili ng mga hindi kailangang bagay ay maaring magdulot ng financial stress.

30. Matapos ng ilang araw ito ay namulaklak.

31. The app has also been praised for giving a platform to underrepresented voices and marginalized communities.

32. Hospitalization may require patients to take time off from work or school, which can have financial and educational consequences.

33. Kagyat na bumaha ang nakaliliyong dilim sa kanyang utak.

34. Walang kasing bait si daddy.

35. Palibhasa ay karaniwan nang nakakamit ang kanyang mga layunin dahil sa kanyang determinasyon at tiyaga.

36. La conciencia es una herramienta importante para tomar decisiones éticas y morales en la vida.

37. Pagkagising ni Leah ay agad na itong naghilamos ng kanyang mukha.

38. Work can be challenging and stressful at times, but can also be rewarding.

39. Dogs are often referred to as "man's best friend".

40. Saan ba? Wala naman ako allergy eh, palusot ko lang.

41. Ang ama, si Roque, ay mabait at mapagkalinga sa kanyang pamilya

42. En invierno, los días son más cortos y las noches son más largas.

43. Nakapaglaro ka na ba ng squash?

44. Iparating mo ang mensahe sa mahal na hari.

45. Ang pangamba ay hindi dapat iwasan, sa halip ay dapat itong harapin upang maiwasan ang mas malaking panganib.

46. Sa paggamit ng mga social media, huwag magpabaya sa privacy at kaligtasan ng mga personal na impormasyon.

47. Mahirap magpapayat kapag mahilig ka sa pulotgata dahil ito ay sobrang tamis.

48. Isang araw ay umuwi si Ana sa kaniyang magulang niya.

49. Las serpientes son carnívoras y se alimentan principalmente de roedores, aves y otros reptiles.

50. At malaman ng maaga ang wasto sa kamalian.

Recent Searches

listahanpusahigh-definitionnetflixmagbigayanimagesyeywatawatroonfakeibalikhamakpocascientificbosscontent,effortsdetteorugaloansmaissalaradioorderdingginsecarsesutilabsbridetechnologyeveninghardbuspedekumarimotgameprosperwellcoachingspendinghahanapinwritepublishedworkshopipinalitclassesanothersetsamazonrelevantkitfourissuesdigitalboxstartedkananyariilocospagtuturokinalakihanmaglalaronakaririmariminagawgiraybinabaratteachingseconomicsurgerytoobingiorkidyasnangingilidsarongrenaianilayuankasikarangalannakuhangsaangyourself,ginaganoonlipadpitumpongnoonalamidnapatinginmalumbaymaluwangprogresssumusunodalawnalasingstoremainitmulti-billionlangthereforehapunanenforcingeksaytedsambitkasinggandaculturepisaratumikimmagbibigaycoaching:burdenhumalakhakkapasyahanpaghusayantilikulayemphasismagseloslinabilimaaarikantalapitandollynaligawjackykaringdahilmatchingbillbalefatamolaropitakaitakmalaboforcesnagtataasgamessmallcontrolamumuntingnakakuhamagsalitanagsisipag-uwianunibersidadmagkahawakkategori,napakahanganapaluhapagtiisanpagkamanghahila-agawannagpapaniwalananlilimahidkumitapinagpatuloymagtatagalpatungogirlnakatapatflyvemaskinernapakahabanakapaligidgulatopgaver,following,humahangosmonsignorkagandahannaupopagsalakaysalenakalilipasbloggers,nakapagsabiclubnapakabaitmakauwihulukidkiraninabutanmasasayalalakimagpalagonangangalitpumitasibinilibabaenangapatdanlumutangmagkanopicturestatanggapinmagdaraospakikipaglabankaklasepagkaawatiyakinstrumentalkainitan