Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. They volunteer at the community center.

2. Holding onto grudges and refusing to forgive can weigh us down emotionally and prevent personal growth.

3. Electric cars can help reduce dependence on foreign oil and promote energy independence.

4. I find that breaking the ice early in a job interview helps to put me at ease and establish a rapport with the interviewer.

5. Ang kanyang galit ay parang nagbabaga, handang sumiklab anumang oras.

6. Microscopes have revolutionized the field of biology, enabling scientists to study the structure and function of living organisms at the cellular and molecular level.

7. Muchas personas pobres no tienen acceso a servicios básicos como la educación y la atención médica.

8. Mula nuon, sa gubat namuhay ang mga matsing.

9. Bukas ay pupunta kami sa isang medical mission.

10. Sinimulan ko ng i-collect lahat ng bibilhin.

11. Online learning platforms have further expanded access to education, allowing people to take classes and earn degrees from anywhere in the world

12. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

13. Paano ho ako pupunta sa palengke?

14. Børns mentale sundhed er lige så vigtig som deres fysiske sundhed.

15. Hindi maganda na supilin ang kalayaan ng mga mamamahayag sa bansa.

16. Waring nawawala ang bata dahil hindi niya alam kung saan siya pupunta.

17. Apa yang bisa saya bantu? - How can I help you?

18. Investment returns are subject to taxes, and investors should consider the tax implications of their investments.

19. Les hôpitaux sont équipés pour fournir des soins d'urgence aux patients.

20. Sorry, hindi ako babae eh. sumubo ako ng pagkain ko.

21. Inalagaan ng mag-asawa ang halaman at nang lumaki ay nagkabunga.

22.

23. Jagiya? hinde parin siya umiimik, Ya Kenji.

24. Eh? Considered bang action figure si spongebob?

25. Selamat ulang tahun! - Happy birthday!

26. Kangina pa ako nakapila rito, a.

27. May sapot pa ng gagamba sa kanilang kisame.

28. May bukas ang ganito.

29. Sa bawat desisyon na ating ginagawa, kailangan nating isaalang-alang ang bawat posibilidad, samakatuwid.

30. Medyo kakaiba ang pusang ito sapagkat makapal ang kulay dalandan na balahibo.

31. The invention of the telephone and the internet has revolutionized the way people communicate with each other

32. Ang aming pagsasama bilang magkabilang kabiyak ay puno ng pagpapahalaga at respeto sa isa't isa.

33. They have been cleaning up the beach for a day.

34. Marahil ay magpapasko na kaya't maraming tao ang nagpaplanong bumili ng mga regalo.

35. Nagtataka ako kung bakit kailangan ko pang maghintay ng matagal bago mo ako sagutin.

36. Después de terminar el trabajo, fuimos a celebrar con nuestros amigos.

37. Nasa ibabaw ng mesa ang bag ni Clara.

38. Naglalaway ang mga manonood habang pinapakita sa TV ang masarap na pagkain.

39. Remember that the most important thing is to get your ideas and message out to the world

40. Sila ay nagpapakita ng dedikasyon sa paglilingkod sa kapwa at sa bayan.

41. Kapag ako'y nasa eroplano, natatanaw ko ang iba't ibang mga pook sa ibaba.

42. Decaffeinated coffee is also available for those who prefer to avoid caffeine.

43. Umupo sa harapan ng klase ang mga mag-aaral nang limahan.

44. Consuming a variety of fruits and vegetables is an easy way to maintain a healthy diet.

45. Dahil lumamang naman sa pagkakataong iyon ang mga mababangis na hayop, sa kanila lumapit si Paniki.

46. Don't worry about making it perfect at this stage - just get your ideas down on paper

47. La esperanza es una luz que brilla en la oscuridad, guiándonos hacia un futuro mejor. (Hope is a light that shines in the darkness, guiding us towards a better future.)

48. Inabot ko naman yung pinggan. Anim na hotdog ang nandun.

49. All is fair in love and war.

50. La creatividad nos inspira y nos motiva a seguir adelante con nuestros proyectos.

Recent Searches

kaarawanhigh-definitiondecreasezoompostcardpshbumahaexamatentospentcompostelabagolamesasamfundlaterclassroomdaydaysiconumiilingoutcharmingerapbilhinbinabalikpicturenakakatandakeepnagpupuntaenvironmentuniqueinternetanimpotentialpossiblecomputereoffersagingsingerredimagingataquesgathernamulatshiprememberguidecurrentumarawkitpersistent,nutslargemanagerincreasedhapasinmereoftenmetodemarahilmasinopi-googlekasalukuyankasintahanautomationelectionskawaldoublemungkahitatanggapincynthiashiftdawnapakahabaguiltykisapmatanahigitankaytayomasayaagam-agampagluluksakamiasbangkanglingidmadungistumatanglawpanitikan,mismojosekakaroonmadulaspantalongpawisagilapilitfeedbackactivityflaviobungadgeneinventionfloorkubokinangusomediaano-anorestkapit-bahayencounterpagkakamaliclassespanghihiyangopgaver,nagsunuranpamahalaankalakihannagtutulakmakikipaglaronagpaalamlumiwagnagmakaawapalapunonagcurvekumidlathouseholdspinagbigyannaabutankabuntisanatensyongminamahalmagsi-skiingnagmadalingnagpakunotnakaraanpinalakingtrainingpacespeedstrengthtakeofteagepalagingagoswalletauditsarilingdioxideduloexhaustedhanapbuhaynakikini-kinitakumembut-kembotmakalaglag-pantynyohinagpisnagmamaktolkitang-kitananlilimahidmakapangyarihanpagka-maktolpunongkahoygratificante,makikitamagbabakasyonpaboritonumerososvisualafternoontindignagsuotkumakainsumusulatmahiyanapapahintonakikitangmahinognakakatabanakauwimakikiligofestivalesnapagpagkainismangyarituktokinuulamnagsinetaxinasaanmaanghangnakabibingingmabatongyumaolabinsiyamtumikimdinalalikod