Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Sa isang pagamutan ng pambansang bilangguan sa Muntinlupa ay makikita ang apat na lalaking may kanya-kanyang karamdaman

2. Ramdam na ang pagod at hingal sa kaniyang pagsasalita.

3. ¿Cual es tu pasatiempo?

4. Technology has also had a significant impact on the way we work

5. Einstein was awarded the Nobel Prize in Physics in 1921 for his explanation of the photoelectric effect.

6. Just because she's quiet, it doesn't mean she's not intelligent - you can't judge a book by its cover.

7. Napakatamis ng halinghing ng hangin sa gubat.

8. El estudio científico produjo resultados importantes para la medicina.

9. The Angkor Wat temple complex in Cambodia is a magnificent wonder of ancient Khmer architecture.

10. Sa paggamit ng mga kagamitan, huwag magpabaya sa tamang pag-aalaga at pagpapanatili nito.

11. AI algorithms can be used to analyze large amounts of data and detect patterns that may be difficult for humans to identify.

12. Wenn die Inflation zu schnell ansteigt, kann dies zu einer Wirtschaftskrise führen.

13. Nakuha ko ang first place sa aking competition kaya masayang-masaya ako ngayon.

14. Sino sa mga kaibigan mo ang matulungin?

15. The company's CEO announced plans to acquire more assets in the coming years.

16. Puedes saber que el maíz está maduro cuando las hojas inferiores comienzan a secarse y las espigas están duras al tacto

17. Uncertainty can create opportunities for growth and development.

18. A dedicated student is willing to put in the extra hours of studying to excel academically.

19. Menjaga hubungan yang harmonis dan menyenangkan dengan orang-orang di sekitar kita dapat meningkatkan kebahagiaan dan kepuasan hidup.

20. Si Rizal ay naglakbay sa Europa at nakikipag-ugnayan sa mga kilalang intelektuwal at lider sa paglaban sa kolonyalismong Espanyol.

21. Kapag mayroong hindi malinaw na impormasyon, madalas na nagkakaroon ng agam-agam sa mga tao.

22. Haha! Bakit masama bang makidalo sa ball ng ibang school?

23. Hindi ko maintindihan kung bakit niya nangahas na kunin ang bagay na hindi sa kanya.

24. The United States also has a capitalist economic system, where private individuals and businesses own and operate the means of production

25. Sa halip na maghanap, sinalat na lang niya ang ibabaw ng mesa para sa relo.

26. Seeking support from friends, family, or a mental health professional can be helpful in managing feelings of frustration.

27. Ang sugal ay isang pampalipas-oras na aktibidad na may kaakibat na panganib ng pagkakabigong pinansyal.

28. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

29. Inialay ni Hidilyn Diaz ang kanyang tagumpay sa Diyos at sa kanyang pamilya.

30. Las plantas perennes viven durante varios años, renovando sus hojas y flores de forma periódica.

31. Si mommy ay matapang.

32. Wives can be loving, supportive, and caring companions to their spouses.

33. Bilang paglilinaw, ang ating proyekto ay hindi pa tapos kaya hindi pa ito maaaring ipasa.

34. Ang aming angkan ay nagpapahalaga sa pagiging matapat sa mga relasyon.

35. Drømme og håb kan drive os fremad i livet.

36. Malapit ang eskuwela ko sa bahay namin.

37. Ang parke sa amin ay mayabong na may malalaking puno at makukulay na mga dahon.

38. Madalas ka bang uminom ng alak?

39.

40. Ano?! Diet?! Pero tatlong plato na yan ah.

41. Pumasok ka na lang sa kwarto. Susunod na lang ako..

42. También trabajó como arquitecto y diseñó varias estructuras importantes en Italia.

43. Ang magulang na mabuti, ang anak na sumusunod.

44. Bumoto ka nang ayon sa idinidikta ng iyong puso.

45. Nangagsibili kami ng mga damit.

46. El arte abstracto se centra en las formas, líneas y colores en lugar de representar objetos reales.

47. Ang pagkakaroon ng malakas na lindol ay binulabog ang mga gusali at nagdulot ng takot sa mga tao.

48. The desire for a baby can be accompanied by feelings of emptiness, longing, and a sense of incompleteness.

49. Kailangan ng mas malawak at mas matatag na suporta sa sektor ng anak-pawis upang malutas ang mga isyu ng kahirapan.

50. Pakibigay ng malakas na palakpak ang lahat para sa ating mga guro.

Recent Searches

high-definitionalagamaestroelvisnapakagandakumidlataninagsisigawcomienzanumiimikiloiloarbejdsstyrkekayabanganvigtignakakabangonpressguropeksmangranadahverahascandidatesinundoadvancementnamangabriellangpaghihingalozoomaskinertitalcdconsidersakimmagpagalingprutasbinatorabbatangeksstandlihimgusgusingbeyondlasonanosagingthoughakinkaninatresomkringparangmababatidtiketoperativosvotesbinginagisingnaiilangmakikiligosumisilipsinaliksiknootinanggapeskuwelanakaliliyongagwadorsamantalangdreamfallapadabogbagsakmay-bahaypintoparusahanpuntahantagaytayinakyatumagawaddictioniniinompesosambaginantaymedyomahuhusayfiverrlivepagkasabitig-bebentevivanaibibigaysumasaliwtumawabusloactorjeepneysikre,cardiganganangpakaininhankananbrasosisentacnicokinauupuangtotoongposporofriendsingaporepinagmamalakiguerreroamazonvaccinesdilawnakagawianpinipisilonline,taga-nayonopisinainasikasomissionofrecenginaabskarangalanmasyadongmontrealnakataasnasagutanbingobutaspagsidlanshutpayatexigenteindependentlytinuturomiradiinroomfianceburgercornersmaghahabionlypiecescampaignsbwahahahahahaiskolawsbakantetabiparkingutilizanfistsirogtilltumindigtinderabigyanhinanapjolibeeroughgapparehasmuligalingpagka-maktolprotestabobotomakapalagmakasalanangwidespreadpagpalitkaysamangangalakalsinkorganizesonidodailynanoodbagamaemocionalhawaiikendisoonipinabalikninanaisumuwiwalkie-talkierailtumambadsawamatitigaskantahangiraypagimbaycrecer