Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Ang pagpapakilala ng bagong lugar o setting ang nagbigay ng bagong perspektibo sa kuwento sa kabanata.

2. La creatividad nos inspira y nos motiva a seguir adelante con nuestros proyectos.

3. Ibig niyang maranasan ang mga bagay na kaiba sa kinalakihan.

4. The President is elected every four years through a process known as the presidential election

5. Sa panahon ng tagtuyot, ang mga ilog at sapa ay halos natutuyo na.

6. Quitting smoking can also lead to improved breathing, better oral health, and reduced risk of premature aging.

7. Hockey can be a physically demanding and challenging sport, but it can also be a lot of fun and a great way to stay active.

8. The charitable donation made it possible to build a new library in the village.

9. Ang paglutas ng mga palaisipan ay hindi lamang tungkol sa pagpapakita ng katangian ng isang indibidwal, kundi tungkol din sa pagpapakita ng kahalagahan ng malawak na kaalaman.

10. Pumunta ka dito para magkita tayo.

11. Los alimentos ricos en nutrientes son fundamentales para mantener un cuerpo sano.

12. The king's subjects are the people who live in his kingdom and are under his rule.

13. Masaya at masaganang na naninirahan ang mga tao dito nagtutulungan at nagbibigayan din sila, kung tutusin perpekto ang bayang ito.

14. Ang mabuting anak, nagpapakilala sa magulang.

15. Nang magretiro siya sa trabaho, nag-iwan siya ng magandang reputasyon bilang isang tapat at mahusay na empleyado.

16. Ang paggamit ng droga ay maaaring magdulot ng mga epekto sa kalusugan ng sanggol kung ang isang buntis na babae ay gumagamit ng droga.

17. Ang paglutas ng mga palaisipan ay nakakatulong sa pagpapalawak ng kaalaman at kakayahan sa pagpapasya.

18. She does not use her phone while driving.

19. Inflation kann auch durch eine Erhöhung der Arbeitskosten verursacht werden.

20. Naging masaya ang aking buhay dahil sa aking mga kaulayaw.

21. The credit union provides better interest rates compared to traditional banks.

22. Paborito nyang panoorin ang Baby shark sa youtube.

23. They plant vegetables in the garden.

24. Si Mabini ay naglingkod bilang siyang "Brains of the Revolution" noong panahon ng himagsikan.

25. Mas maganda pa ring magpatawad kaysa magtanim ng inis sa puso.

26. Hindi mapigil ang pagkakatitig niya sa pagkain na naglalaway na sa harap niya.

27. Helte kan inspirere os til at tage positive handlinger i vores eget liv.

28. If you want to get the best deals at the farmer's market, you have to be the early bird.

29. L'intelligence artificielle peut aider à prédire les comportements des consommateurs et à améliorer les stratégies de marketing.

30. Ella yung nakalagay na caller ID.

31. Mahalagang magkaroon ng emergency fund upang maiwasan ang pagkakaroon ng utang sa panahon ng krisis o emergency.

32. Hindi dapat natin tolerahan ang anumang uri ng paglapastangan dahil ito ay sumisira sa mga pundasyon ng pagkakaisa at paggalang sa isa't isa.

33. Mahalagang mag-ingat sa ating kalusugan, datapapwat ay hindi natin nakikita ang mga mikrobyo at virus na nagdadala ng sakit.

34.

35. He tried to keep it a secret, but eventually he spilled the beans.

36. L'entourage et le soutien des proches peuvent également être une source de motivation.

37. Niluto nina Tony ang isda sa kusina.

38. Cheating is the act of being unfaithful to a partner by engaging in romantic or sexual activities with someone else.

39.

40. Datapwat mali sila ng akala, sapagkat ang anak ay hindi nagbago.

41. Ailments are a common human experience, and it is important to prioritize health and seek medical attention when necessary.

42. Ang sugal ay isang problema ng lipunan na dapat labanan at maipagbawal para sa kapakanan ng mga tao.

43. Sa dapit-hapon, masarap mag-stroll sa mga kalye at maghanap ng masarap na kainan.

44. Naglinis kami ng bahay noong Linggo.

45. Kailan po kayo may oras para sa sarili?

46. Sa mga lugar na may tag-ulan, kadalasang mas madalas magkasakit ang mga tao dahil sa mas mabilis na pagkalat ng mga sakit sa panahon ng malakas na ulan.

47. Nous avons choisi un thème de mariage champêtre.

48. Sa aking balkonahe, ako ay nagtatanim ng mga maliit na halaman upang magkaroon ng kahit konting berdeng espasyo.

49. They go to the library to borrow books.

50. Hindi namin mahanap ang tarangkahan ng bahay mo kaya't nag-text kami sa iyo.

Recent Searches

thankhigh-definitionpangilbalotfitumalissuwailjuanpusapamanmaliitreviewkailanimbesiyakfiverrkendihabitbinatilyoguidanceclassesnapapasabaytongasinmalapadpshbilinfridayjanemaisallottedipatuloyparisamakatwidnakasuotbotonakatinginganayhinogmayabangtwo-partymedyoaniyameansfilmsofferdidingtoonilutomeancomestrategyilaninuminnaginginisuriusedmillionskumarimotreducedkalanlabingscientistmatangmeetknowledgeexistmapfallgenerabawhetherdraft,styrerawaremaratingbroadcastingcouldmarkedslaveimpitkadalagahangchefclearlcdrightfarobstaclesbeginningmakauuwipinakamatabangkomunikasyonnagngangalangnakaupokinakitaanlaki-lakimestpinakamahalagangnangagsipagkantahanpinagmamalakipagkatakotnabighanisasamahantumutubohiwaisasabadnag-aagawanpaglisandekorasyonpaglalabadapanghihiyangpaumanhinnahuhumalingpagkaimpaktonegosyantenag-iisasabadongerhvervslivetespecializadastinungomagpaliwanagpamanhikanibinigaytennismauupopagkagisingpagsubokngumingisiinilistamaintindihankinalilibinganawtoritadongjuegospaghaliktumunogpinapataposmaisusuotkumakantaairportmaipagmamalakingibinibigayi-rechargetumatanglawfollowingmarangaljeepneynasunogsumasayawmusicdepartmentmakilalamagbabalamalalakiganapinbinentahanlumusobtelebisyonlagnatsalaminperyahannasasaktannilapitanpampagandalabahinnandiyanwonderasahansahodbibigyanhinanapcitytinanggapsuccessfulsalarintapatsumayaklasrumgoshbinulongbingibevarenatandaansupilindiscoveredbinatangchoosepakealamanywherebumabahabateryamrspagejenaeducationsagaplaborlamesabakitsiyaloans