Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Kapag dapit-hapon, masarap mag-relax sa veranda habang nanonood ng sunset.

2. Utak biya ang tawag sa mahina ang pag iisip

3. Nagsimula na akong maghanap ng mga magagandang lugar upang dalhin ang aking nililigawan sa isang romantic date.

4. The elephant in the room is the fact that we're not meeting our sales targets, and we need to figure out why.

5. Los desastres naturales, como las inundaciones y sequías, pueden tener un impacto significativo en el suministro de agua.

6. Elvis Presley's life and career are a fascinating story of a young man who rose from humble beginnings to become one of the biggest stars in the world

7. I nogle dele af Danmark er det traditionelt at spise påskelam til påskefrokosten.

8. The number of stars in the universe is truly immeasurable.

9. Ang mga hudyat ay maaaring maging bahagi ng kultura at lipunan, na may iba't ibang kahulugan sa iba't ibang konteksto.

10. Nakakapagod pala bumaba ng bundok.

11. Gusto kong malaman mo na may gusto ako sa iyo kahit na hindi ko ito masabi sa iyo nang personal.

12. Representatives often collaborate with other officials and stakeholders to achieve common goals and address broader societal issues.

13. Napakabuti ng doktor at hindi na ito nagpabayad sa konsultasyon.

14. Mahal ko iyong dinggin.

15. Magkita na lang tayo sa library.

16. Nagkakatipun-tipon ang mga ito.

17. Ang kanilang kaharian ay malapit sa isang maliit na gubat na kung saan ay malayang nakakapamasyal ang mayuming kagandahan.

18. Mi mejor amigo siempre está ahí para mí en los buenos y malos momentos.

19. For doing their workday in and day out the machines need a constant supply of energy without which they would come to a halt

20. Lack of progress or slow progress towards a goal can also be a source of frustration.

21. Nagtayo ng scholarship fund si Carlos Yulo para sa mga batang gustong mag-aral ng gymnastics.

22. Ang guro ang pinagpalaluan ng lahat ng kanyang mga estudyante dahil sa kanyang kabaitan.

23. Ang bango ng kape sa umaga ay nagbibigay ng mabuting simula sa araw.

24. Pinaliguan ni Simon ang sanggol.

25. Hockey has produced many legendary players, such as Wayne Gretzky, Bobby Orr, and Mario Lemieux.

26. Kailangang di niya malimutan ang araw na ito.

27. En la universidad, hice muchos amigos nuevos de diferentes partes del mundo.

28. Ang pangungutya ay hindi magbubunga ng maganda.

29. Sabay nanaog at pumitas ng halaman sa hardin at nagtuloy sa ilog upang pagmasdan ang bulaklak sa kanyang buhok.

30. Kailangan kong magtiwala sa aking sarili upang maalis ang aking mga agam-agam.

31. Kailan ba ang flight mo?

32. Ayaw mo ba? tanong niya sa malungkot na tono.

33. Ibinenta ni Mang Jose ang karne kay Katie.

34. Hindi umabot sa deadline ang kanyang report, samakatuwid, binawasan ang kanyang grado.

35. Nag-reply na ako sa email mo sakin.

36. I am absolutely confident in my ability to succeed.

37. Alam mo ba kung bakit takot si Cross sa hospital?

38. Ilan ang silya sa komedor ninyo?

39. Tantangan hidup dapat memperkuat hubungan dengan orang-orang terdekat, karena mereka dapat memberikan dukungan dan perspektif yang berharga.

40. Mamimili si Aling Marta.

41. He is watching a movie at home.

42. Sa gitna ng kalsada, ang nagdudumaling kotse ay maingat na dumadaan sa intersection.

43. Disente naman talaga ang kanilang pamilya.

44. A mi esposa le encanta hacer manualidades como pasatiempo.

45. It was invented in England by the Scottish scientist J.N. Baird in 1928 and the British Broadcasting Corporation was the first to broadcast television images in 1929. Previously the radio helped us hear things from far and near.

46. Tumakbo siya para sa pagka-pangulo noong 1935 ngunit natalo kay Manuel Quezon.

47. Børn bør have adgang til uddannelse og sundhedsydelser uanset deres baggrund eller socioøkonomiske status.

48. Sa wakas, nangahas siyang sundin ang kanyang pangarap, anuman ang mga balakid na nasa kanyang harapan.

49. Elektronisk udstyr kan hjælpe med at forbedre effektiviteten og produktiviteten af ​​virksomheder.

50. Si Marian ay isang sikat na artista sa Pilipinas.

Recent Searches

high-definitiontamissalatsitawfulfillingbecameroselleasiaticpromotepinatiraestateiyakfatherpunong-punolangkayusanyabinibinistilltoothbrushnakasuotestarfiahidingorugaopotresosakamininimizenakatingingattractivekuyaginisingitinalisorebuwalkaringharingeeeehhhhgreencardfakesumindiipagamotmaskbobomightincreasinglypdapostercomeatatheseplayswalleteveningnotkumarimotdeleworryakovedinisautomaticfallhelprememberviewbetainteligentesleftcountlessinteriorguiltyeasybehalftrainingpinalakingauthoramounttontinatawagmaputirelokaarawanbihirangtatagalmawawalalumitawtindacosechar,mwuaaahhlayasiigibtryghedbeastcontent,pagsasalitaalttingnannatitiyakfauxtwinklenalalabipanimbangkumitatatanggapinkonsyertobinanggaimpactednapatakbonapakahabainabutankalabawtanongtusongvelstanddoespopularsenategospelviolencemodernespeechesnagre-reviewlilylolanakahigangpagdukwanginalalapagkalitodropshipping,tumiragasmenpaghihirapsasakaynatatanawturismopumasoknagliliyabpagbatihinagisracialumigiblayawbulakcontrolacombinednagreklamotaglagasdinalababasahintypesitinuturotmicasinkoverviewflexiblekisapmatasumimangotbaboytsegrinswantpulgadaeffektivpulongmatchingtinaasanospitalbatang-bataevolveochandosipagisingdamdamindaaninalokhalikahadmoviesarmededitornegativesumangkartonstudentsmentalpanguloleemabutingidea:bagalkalayaannanghihinamadkinabubuhaynakadapanakasandigwalkie-talkienakaliliyong