Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Las hojas de mi cuaderno están llenas de garabatos y notas.

2. Kapag dapit-hapon, masarap magpahinga sa parang habang nakatingin sa mga bituin.

3. "A house is not a home without a dog."

4. Naghanap siya gabi't araw.

5. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

6. 5 years? naramdaman ko yung pag iling niya, 1 year..?

7. Television has also had an impact on education

8. Drømme kan inspirere os til at tage risici og prøve nye ting.

9. Inialay ni Hidilyn Diaz ang kanyang tagumpay sa Diyos at sa kanyang pamilya.

10. Lucas.. sa tingin ko kelangan na niyang malaman yung totoo..

11. Dancing all night at the club left me feeling euphoric and full of energy.

12. El parto natural implica dar a luz a través del canal vaginal, mientras que la cesárea es una operación quirúrgica que implica hacer una incisión en el abdomen de la madre.

13. Ang aking ina ay isang magaling na mananahi.

14. Tila may nais siyang ipahiwatig sa kanyang mga kilos.

15. Sa panahon ngayon, mahirap makahanap ng mga taong bukas palad dahil sa kahirapan ng buhay.

16. Jagiya? hinde parin siya umiimik, Ya Kenji.

17. Ano ang gagawin ni Trina sa Oktubre?

18. Las hierbas deshidratadas se pueden almacenar por más tiempo sin perder su sabor.

19. Sa aming klase, tinalakay namin ang iba't ibang anyo ng panitikan ng Pilipinas.

20. Nakapagtala ang CCTV ng larawan ng salarin na lumabas sa pagsasagawa ng krimen.

21. En invierno, el cielo puede verse más claro y brillante debido a la menor cantidad de polvo y humedad en el aire.

22. Libreng nakakakuha ng atensyong medikal ang lugar nila Alfred.

23. Ang produktong ito ay may mataas na kalidad, samakatuwid, marami ang bumibili nito.

24. Ignorar nuestra conciencia puede hacernos sentir aislados y desconectados de los demás.

25. Fathers can be strong role models, providing guidance and support to their children.

26. May isa pang nagpapaigib sa kanya.

27. Sa tuwing Undas, bumibisita ang mga pamilya sa sementeryo upang mag-alay ng mga dasal para sa mga yumaong kamag-anak na maaring nasa purgatoryo pa.

28. Napadungaw siya sa kanyang cellphone at napansin na mayroon siyang mga hindi pa nabasang mensahe.

29. Huwag magpabaya sa pag-save at pag-invest ng pera para sa kinabukasan.

30. Ang mga hudyat ay maaaring maging bahagi ng kultura at lipunan, na may iba't ibang kahulugan sa iba't ibang konteksto.

31. Promote your book: Once your book is published, it's important to promote it to potential readers

32. Tila hindi pa tapos ang laban, kaya’t kailangan pa nating maghanda.

33. Ngunit natatakot silang pumitas dahil hindi nila alam kung maaring kainin ito.

34. Anong klaseng karne ang ginamit mo?

35. Di-kalayuan sa gripo ay may isang tindahan.

36. Ibinigay niya ang kanyang pera para matugunan ang mga pangangailangan ng komunidad.

37. Sa Chinese New Year, ang mga tao ay nagpapakasaya at nagdiriwang ng malakas.

38. The company's CEO announced plans to acquire more assets in the coming years.

39. Amazon's entry into the healthcare industry with its acquisition of PillPack has disrupted the traditional pharmacy industry.

40. The team has had several legendary coaches, including Phil Jackson, who led the Lakers to multiple championships during the 2000s.

41. Inalagaan niyang mabuti ang halaman at tinawag itong Pinang, Sa palipat-lipat sa bibig ng mga tao ang pinang ay naging pinya.

42. Isa sa kanyang kasamahan sa bilangguan ay si Tony

43. The scientist conducted a series of experiments to test her hypothesis.

44. Children's safety scissors have rounded tips to prevent accidental injuries.

45. Nasi kuning adalah nasi kuning yang biasa disajikan pada acara-acara tertentu dan dihidangkan dengan berbagai lauk.

46. Ang mga lumang talaarawan at dokumento ay dapat na itinuring bilang mahalagang bahagi ng kasaysayan.

47. Sa gitna ng katahimikan ng gabi, narinig ang panaghoy ng isang inang nawalan ng anak.

48. Sinalat niya ang kanyang bulsa ngunit wala roon ang kanyang cellphone.

49. Nakaupo ang babaeng nakasuot ng salamin.

50. Nagluto ako ng paborito kong pagkain kaya masayang-masaya ako ngayon.

Recent Searches

high-definitionmalikotfathersusinaggalatagalogsonidohvernag-replypagbatifallnagbasabangkongipaliwanagbarrocomapaibabawparangsawabilinorugachadlayasshopeelutobilhinfakeutilizansumamaexampaanocoachingprofessionalimaginationcebumapaikotlivebigauditeveningenchantedconnectionbroadcesfacilitatinghelpfulthirdinternalpeterthanksgivingpakealamsellingnagbibirosupplyprogrammingbasahaninfectiouscareerbarorektanggulokastilaresultaalisnganapakahabausoremembermagkikitanangagsipagkantahannag-oorasyonhinawakanmalilimutanmakikipag-duetonalulungkotnapakatagalnagkitanagbabakasyonpagkakatayohubad-barokinagalitanmaihaharapmakikipagbabagnapapatungolumalakiressourcernepinapakiramdamanhampaslupanagreklamonaghuhumindigentrancekare-karenahuhumalingtatlumpungmaglalaropagbabayadincluirmangahasengkantadangmagkasamamensaheencuestashayaanpasaherotumamataosmaskinernamuhaydaramdaminmaliwanagpinasalamatantravelpinuntahankabundukanpagtataasnag-aagawanhurtigerekilongnakalockkumirottumalonpartsibinigaypumilinapahintobutikikapaligirankagyatmaasahanintramurosisinusuotperyahankisapmatapundidopalasyoumibigbungapaladhinanakitgawadisentesampaguitapitokanayanghidingnagniningningnuevospa-dayagonalpinagkaloobanmaongnatutulogbaryotalagahojasnatulakkuwebacarlobayaniyarilegacyfulfillingmatulisherramientakagandakasoflexiblegransumindilatestzoomkaninaugalisiglobilerfonooutpostbarongbituinprogramming,maicostartedniligawanclaseswindowinteractnanalospellingnahantadvelfungerendekatutubotungawkatagablusalcdtahananpalikurantradisyonattractiveprogressmahahabadeclareinulit