Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Masarap ang pagkakaluto mo ng kare-kare.

2. Tantangan dapat merangsang pertumbuhan pribadi dan mengubah perspektif kita tentang hidup.

3.

4. Det er vigtigt at respektere og anerkende transkønnede personers kønsidentitet og bruge deres præfererede pronominer og navne.

5. If you spill the beans, I promise I won't be mad.

6. Galing sa brainly ang isinagot ko sa asignatura.

7. Alam ko ang kabutihan ng iyong kalooban.

8. He applied for a credit card to build his credit history.

9. Siya ang may pinakamataas na grado sa klase, samakatuwid, siya ang napiling valedictorian.

10. Cutting corners might save time now, but it will cause problems down the line.

11. Rektanggulo ang hugis ng mesa namin.

12. The information might be outdated, so take it with a grain of salt and check for more recent sources.

13. Estudyante sina Rita at Fe sa UP.

14. The movie was rated R, and therefore she wasn't allowed to watch it.

15. Siya ang aking pinakamatalik na kaulayaw sa opisina.

16. Lumiwanag ang aking puso sa simpleng "salamat."

17. Sa kabila ng kanyang tagumpay, nananatiling humble at grounded si Carlos Yulo.

18. Halos dalawang linggong nag quarantine ang pamilya ni Josie matapos mag positibo sa covid.

19. Sa kabila ng panganib, nangahas ang grupo na pumasok sa nasusunog na gusali upang may mailigtas.

20. ¿Quieres algo de comer?

21. Itinuturo siya ng mga iyon.

22. Mi esposo y yo hemos estado juntos por muchos Días de San Valentín, pero siempre encontramos una manera de hacerlo especial.

23. Nahuhumaling ako sa pagbabasa ng mga self-help books dahil nagbibigay ito ng inspirasyon sa akin.

24. Ariana is also an accomplished actress in film, with roles in movies like Don't Look Up (2021).

25. Es importante elegir un powerbank de buena calidad para garantizar una carga segura y eficiente.

26. "Ang batang matalino, may alam sa lahat ng bagay" ay isang bukambibig na nagpapahayag ng husay at talino ng isang batang may malawak na kaalaman.

27. Ang Ibong Adarna ay may tatlong kapatid na naghahangad na maagaw ang mahiwagang ibon para magamit sa kanilang sariling kaharian.

28. Pinagsisihan niya ang mga salitang hinugot niya mula sa kanyang galit.

29. The telephone quickly caught on, and by 1878, Bell's company, the Bell Telephone Company, had more than 50,000 subscribers

30. Kung siya ay salamangkero, bakit hindi niya ginamit ang kapangyahiran niya sa akin?

31. Nanatili siya sa isang mataas na puno at nagmasid-masid ulit muna ito at inantay kung sino ang mukhang nananalo.

32. I am absolutely determined to achieve my goals.

33. Batman, a skilled detective and martial artist, fights crime in Gotham City.

34. Mahabang pangungusap ang isinulat ni Lito sa pisara.

35. Det har også ændret måden, vi interagerer med teknologi

36. The Victoria Falls in Africa are one of the most spectacular wonders of waterfalls.

37. During the holidays, the family focused on charitable acts, like giving gifts to orphanages.

38. Ingatan mo ang cellphone na yan.

39. Hindi maganda ang epekto ng laging pagmamangiyak-ngiyak dahil ito ay maaaring maging dahilan ng depresyon at iba pang mental health issues.

40. Magandang araw, sana pwede ba kita makilala?

41. Mahalaga ang papel ng mga organisasyon ng anak-pawis sa pagtitiyak ng kanilang mga karapatan.

42. May mga kuwento sa baryo na ang albularyo ay minsang nagpagaling ng isang taong naparalisa.

43. Lumapit siya sa akin tapos nag smile. Nag bow ako sa kanya.

44. Nanghiram ako ng bicycle para sa isang bike race.

45. The pursuit of money can have both positive and negative effects on people's lives and relationships.

46. The scientific study of astronomy has led to new insights into the origins and evolution of the universe.

47. Ang paborito niyang laruan ay Beyblade.

48. Dinala niya ang regalo sa tarangkahan ng bahay ng kaibigan niya.

49. Nag-aral kami sa library kagabi.

50. Ang lakas mo uminom wala ka naman ambag.

Recent Searches

high-definitionponggardenpigingnoonadverselyvotesdalandanbalingfurytomaritakmagpuntacontent,haringangalgreatestarwerepulubipaskonagdarasalhdtvskypepakilutotextoinalalayannalasingvedconcernsumiinituridontcoaching:watchcandidatepeterageeksammaaganglabananreportoverviewshockinterpretingpresssequetutorialsnapilingguidewithoutextrascaleslavecommunicatediyanpaki-drawingnatutuwapauwinagcurvepackagingkabilangbilhanosakasiyamfrienddegreesiiwasantienesiyentosmababasag-ulosagottubigmagsasalitanakikini-kinitakinauupuangpaghalakhakobserverermumurareserbasyonmagkakagustonangangahoykumikilosimpormagpagalingdadalawinnapapasayanakalagaypagsalakaykinikitahealthiernakabulagtangpinakamagalingnakakapamasyalmakikitulognakakatabalumakipioneerfilipinapambahaykatuwaanumiimikiniindapasyentemakabawimagbibiladsumusulatpambatangisinaboytelebisyonkatolisismoeksempelpinauwikanginamaasahanjingjingsurroundingskainitanlifeoperativosbilibidpatawarinpropesorlungsodkangitankesonagkantahannapadpadpagsusulithinatidaayusinisinalaysaynamilipitkassingulangrespektivedakilangebidensyalakadbiyernesundeniablearturobook,hanapindespuesbarangaybesespokernapadaanmagsimulamasukolumaliscnicoaddictiontokyokargangkasoytalagagigisingperangwalonginulitpatisignzookinsefrescomestmoderneproductionawapangitnasabingtseblusangtamabroughtbriefnambroadcastbanggisingpeepgearpatalikodadmiredgamitnoodkailanganabenepayofficelatestwidesumasambaoveralleffectsettingbroadcastsfencingcorrecting