Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Sa takip-silim, nakakapagbigay ng magandang silip sa mga bituin at buwan.

2. Unti-unting nakakabangon ang ekonomiya ng Pilipinas matapos tanggalin ang lockdown.

3. Mahilig sa paglilinis si Susan kaya't hindi siya nag-aalala kapag kailangan niyang maglaba ng malalaking bagay.

4. Kebahagiaan bisa ditemukan dalam momen-momen kecil sehari-hari.

5. Hindi ko naiintindihan kung bakit nila gustong gawin ito kaya ako ay tumututol.

6. Ang matanda ay malilimutin na kaya’t kailangan niya ng alalay sa pag-alala ng mga bagay.

7. Has he spoken with the client yet?

8. Ang hinagpis ng buong bansa ay naging lakas upang magkaisa sa harap ng pagsubok.

9. Inakalang magugustuhan ng lahat ang ideya niya, pero tinanggihan ito.

10. Kailangan nating bigyan ng tamang suporta at pag-unawa ang mga taong madalas mangiyak-ngiyak upang matulungan silang lumampas sa kanilang pinagdadaanan.

11.

12. Research: Depending on the subject of your book, you may need to conduct research to gather information and support your ideas

13. Les enseignants peuvent enseigner différentes matières telles que les sciences, les mathématiques, la littérature, etc.

14. The meat portion in the dish was quite hefty, enough to satisfy even the hungriest of appetites.

15. Hinde ko alam kung bakit.

16. Wag mo naman hayaang mawala siya sakin.

17. Angelina Jolie is an acclaimed actress known for her roles in films like "Tomb Raider" and "Maleficent."

18. Comer saludable es esencial para mantener una buena salud.

19. Hindi ka ba papasok? tanong niya.

20. Binibigyang halaga ng mga Pilipino ang talambuhay ni Dr. Jose Rizal bilang isang pambansang bayani.

21. Sa bawat salita ng kundiman, nararamdaman ang pait ng paghihintay at pangungulila.

22. El powerbank utiliza una batería recargable para almacenar energía.

23. Saan kami kumakain ng mami at siopao?

24. Tila nagbago ang ihip ng hangin matapos ang kanilang pag-uusap.

25. Eine klare Gewissensentscheidung kann uns ein gutes Gefühl geben und unser Selbstbewusstsein stärken.

26. Dahil sa kagustuhan ng mga tao na matuto ng iba't ibang wika, yumabong ang mga language schools sa bansa.

27. I set my alarm for 5am every day because I truly believe the early bird gets the worm.

28. Me cuesta respirar. (I have difficulty breathing.)

29. OMG. Makalaglag-panty si Kuya!!

30. Einstein was known for his sense of humor and his love of sailing.

31. Online business: You can start your own online business, such as dropshipping, e-commerce, or software development

32. Pagkatapos kong ipagbili ito, bibili ako ng pagkain natin.

33. Kebahagiaan sering kali tercipta melalui perspektif positif, menghargai hal-hal sederhana, dan menikmati proses hidup.

34. Medarbejdere kan opnå ekstra fordele som bonusser eller tillæg for deres fremragende arbejde.

35. Habang naglalakad ako sa dalampasigan, natatanaw ko ang malalaking alon na dumadampi sa baybayin.

36. Disente naman talaga ang kanilang pamilya.

37. Dahil sa pagkabigla ay hindi na nakapagsalita ang binata at ito ay napaluha na lang.

38. We have finished our shopping.

39. I was going to surprise her, but I accidentally spilled the beans.

40. Nous avons prévu une séance photo avec nos témoins après la cérémonie.

41. If you spill the beans, I promise I won't be mad.

42. Sa paggamit ng mga social media, huwag magpabaya sa privacy at kaligtasan ng mga personal na impormasyon.

43. Have you studied for the exam?

44. Naglaro sina Paul ng basketball.

45. The Cybertruck, an upcoming electric pickup truck by Tesla, has garnered significant attention for its futuristic design and capabilities.

46. Ilang tao ang nahulugan ng bato?

47. Les personnes âgées peuvent être victimes d'abus ou de négligence de la part de leur entourage.

48. Los remedios naturales, como el té de jengibre y la miel, también pueden ayudar a aliviar la tos.

49.

50. It has revolutionized the way we communicate, allowing us to talk to people anywhere in the world at any time

Recent Searches

high-definitioninimbitamatapangkasaysayaneducationnaminlegendscryptocurrencyboksingpostcardwalangharingbabesbarnesbuwansubalitkerbbatokipinadalasilbingsipatinanggappeace1787arguemininimizeinomcomunicanqualitybangkapasanperangproblemaitinalisinabidedication,petsaaalispasyaabenetenpag-aapuhapjoykarnabalmovingbumabaheisigebulsabarfuncionescommunicationsbumugasciencestudycurrentcomunicarseberkeleymasterviewcontentfrogstreaminghalosevenbeforesumagotfridayisinagotmakapangyarihanpinuntahankasiyahanmasamangbranchwidelyginhawamaliligospentcontinuedspecializedpadabogkabutihanheleumaagosnatalopag-ibignagtatakbocomputersundhedspleje,magnakawhilingnagmamadalimatalinohuertonaiinggitgotkasogagambakasalukuyanadverselyespigastiyakanpetsangisinalangwhilekusineromagtatampoadvancementthanksgivingdawrawcommercetumawaindustriyanapaluhatatawagkapatawaranjobsnapapasayapanghabambuhayvirksomhederkagalakanmumuratravelerpinagpatuloyikinabubuhaynagagandahangayunmannagre-reviewnakakapamasyalnakaluhodvisuallagnatmagpagupitpaginiwanoktubrepisaramakikiligokumalmainvestjolibeeunahinpagkapasoknagkalapitukol-kaygandahanpinagkiskispagmamanehomarasiganhulihanopisinamanatilimagpasalamatmagkasabayyouthlondonkumakantakinalilibingantulongbinge-watchingmaghilamosikinatatakotpahabolsignalipinauutangpalakagubatanpicturesnaglutolumagomagamotnapasigawvaliosadesign,eksport,rieganakangisingbinentahangovernorsnilaosnakisakaylikodvegasmalilimutanbiglaanibabawnapadpadeconomickundimanarturoflamenconapadaankamalayanmauntognatayopokerturoncurtainsmatangumpaymataas