Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Maraming tao ang nagpaplastikan sa harap ng ibang tao para lang mapasama.

2. Mahalagang magtiwala sa ating kakayahan upang maabot natin ang ating mga pangarap, samakatuwid.

3. Eksport af tøj og beklædningsgenstande fra Danmark er også stigende.

4. Yumabong ang pagkakaisa ng mga tao sa panahon ng krisis.

5. Elektronikken i et hjem kan hjælpe med at forbedre komfort og livskvalitet.

6. Lumingon ako sa kanya. Kita ang paga-alala sa mga mata niya.

7. Kung may isinuksok, may madudukot.

8. Nakakatuwang malaman na maraming kabataan pa rin ang nakikinig at nakakatuklas ng kagandahan ng mga kanta ng Bukas Palad.

9. Kapansin-pansin ang dami ng mga insekto na naglipana sa gabi.

10. Masama pa ba ang pakiramdam mo?

11. Pulau Bintan di Kepulauan Riau adalah tempat wisata yang menawarkan pantai yang indah dan resor mewah.

12. In recent years, television technology has continued to evolve and improve

13. Women have a higher life expectancy compared to men, on average.

14. Ano ang ininom nila ng asawa niya?

15. Ibibigay kita sa pulis.

16. Nagliliyab ang mga damdamin ng mga tao habang sila ay nagpoprotesta sa kalsada.

17. The website's loading speed is fast, which improves user experience and reduces bounce rates.

18. Mahirap magsalita nang diretsahan, pero ito na - crush kita.

19. Ipaliwanag ang mga sumusunod na salita.

20. Emphasis is an important tool in public speaking and effective communication.

21. The Constitution divides the national government into three branches: the legislative, executive, and judicial branches

22. Cheating is the act of being unfaithful to a partner by engaging in romantic or sexual activities with someone else.

23. It was founded in 2012 by Rocket Internet.

24. Hinawakan ko na lang yung pisngi niya. Matulog na tayo.

25. Pigain hanggang sa mawala ang pait

26. Puwede ka ba sa Miyerkoles ng umaga?

27. Today, Amazon is one of the world's largest online retailers.

28. Saan ka galing? bungad ni Maico saken pagpasok ko s condo.

29. Nag-iyakan ang dalawang batang sina Maria at Jose.

30. Hi, we haven't been properly introduced. May I know your name?

31. May galak na sumusuno sa kanyang dibdib habang pinagmamasdan ang pagkapuno ng sinundang balde.

32. Children's safety scissors have rounded tips to prevent accidental injuries.

33. Nasa ganito siyang kalagayan nang bigla niyang maramdaman ang isang ubos-lakas na sipa sa kanyang pigi.

34. Natuto siyang lumaban sa kaniyang mga magulang.

35. May problema ka ba? Kanina ka pa tulala eh..

36. Tuwing may sakuna, nagkakaisa ang mga Pinoy sa pagtulong sa kapwa.

37. Naramdaman kong nag vibrate yung phone ko.

38. La realidad es que a veces no podemos controlar lo que sucede.

39. Nagugutom na din ang mga tao sa lugar nila at ang dating mapagbigay na mga tao ay nag-aagawan na.

40. Habang nakaluhod, dalawang kamay niyang tinutop ang pisngi.

41. Ito ang tanging paraan para mayakap ka

42. Ipinahamak sya ng kanyang kaibigan.

43. Hindi dapat maapektuhan ng kababawan ng mga tao ang ating mga desisyon sa buhay.

44. Sana maintindihan mo kung bakit ako nagagalit at nag-iinis sa iyo.

45. Banyak orang di Indonesia yang mengadopsi kucing dari jalanan atau shelter kucing.

46. Ang pagmamalabis sa pagsasalita ng masasakit na salita ay maaaring magdulot ng alitan at tensyon sa pamilya.

47. Gusto ko na magpagupit ng buhok.

48. Hindi nag-iingat ang bata kaya siya naaksidente sa kalsada.

49. Anong oras gumigising si Katie?

50. Two heads are better than one.

Recent Searches

high-definitionmarmaingmaibalikvetonahihilobalangpanindangkarapatantsakagoalkinaingabrielpatunayanmalumbaytypemagandangguerrerogrammarsoccerkalakingkagandapakilutomalambingnaggalayariwordundeniableunconstitutionaluloalexanderscottishubuhintuwangtunaytraveltrasciendetokyohamaktiyanbatitemparaturatatawaganyelotataastanodbataytangekstamaanconnectingtaketabihanorugamestsumibolsumabogstrategiessteersitawsino-sinohalinglingsikmurasigawsesameselebrasyonschoolsasakyanpocasapatospicssapagkatsanggolfridaysabihinbumababarevolutionizedcallerrestawranrailwaysfakepublishingabipublicationpopulationpinyapinalambotpinagalitanhumanospesosvotespdapasensiyalabanroseparkebluepoliticalparatingbotepapalapitpapagalitanpanatagideyapanalanginipinikitpamilyatvscoatpakealampakakasalanspecializedpagtuturopagtawapagtataaspagpapasanpagpapakainpaglalaitpagkabatapabalingatorderinochandonocheyeseeeehhhhnilutongusongumitibalenaulinigannatutulognatulognatingalanathannariningnapapalibutannapakagandanapagodnanonoodnangahasnamumulotlaylayforcesnakakaanimpasangnatingnahulipyestanagreklamomulinagliliyabfuenaghuhumindignag-iisapapeliconnabiglapupuntamayroonartificialtumiramauliteveningmasakitdragonrestfriesmartialenvironmentaddislamanirahansummitnicerecentmamayabeforeformmalalimmakausapmakatidoesmakapagsabieffectmahinogcuandomahinadivisionnevermagpapigildumaramimagpalibreahitmagkasabaymagkakaanakeksportenmagbabalamagbabagsikmagawangmag-aralkubyertoslily