Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Ang tubig-ulan ay nakakatulong sa pagpapanatili ng balanse ng mga ekosistema.

2. His invention was an improvement over earlier attempts to create a long-distance communication device, such as the telegraph, which could only transmit messages in Morse code

3. Kaya't tama lamang na ito rin ay kanyang ipapamana sa nag-iisang anak.

4. The weather is holding up, and so far so good.

5. Masarap ang pagkakaluto mo ng kare-kare.

6. Magkano po sa inyo ang yelo?

7. Bakit ho, saan ninyo ko dadalhin?

8. Pinadala na nya ang kanyang resignation letter sa pamamagitan ng email.

9. Marahil ay hindi mo pa nakikita ang bagong pelikulang ito kaya't dapat mo itong abangan.

10. Il existe un certain nombre d'organisations et de programmes qui offrent de l'aide aux personnes luttant contre la dépendance au jeu.

11. I always make sure to ask a lot of questions to break the ice and get to know my new coworkers.

12. Binabaan nanaman ako ng telepono!

13. Hindi matanggap na malisan sa kanyang iniibig ay mahigpit nyang hinawakan ang kamay ng prinsipe.

14. Holy Saturday is a day of reflection and mourning, as Christians await the celebration of Christ's resurrection on Easter Sunday.

15. Mahalagang regular na magpatingin sa dentista upang maiwasan ang mga dental problem.

16. Mengatasi tantangan hidup membutuhkan ketekunan, ketabahan, dan keyakinan pada kemampuan kita sendiri.

17. Jacky! si Lana ng sagutin ko ang CP ko.

18. Patients may need to follow a post-hospitalization care plan, which may include medications, rehabilitation, or lifestyle changes.

19. La paciencia nos da la fortaleza para seguir adelante.

20. Ang matanda ay nagalit at pinalayas ang bata.

21. Ito ba ang papunta sa simbahan?

22. Hindi ko alam kung kakayanin ko, pero sana pwede ba kitang ligawan?

23. Hindi dapat natin ipagwalang-bahala ang mga babala at paalala ng mga eksperto, samakatuwid.

24. I complimented the pretty lady on her dress and she smiled at me.

25. A lot of rain caused flooding in the streets.

26. Las escuelas también pueden tener una biblioteca y recursos educativos en línea para los estudiantes.

27. Los héroes pueden ser tanto figuras históricas como personas comunes que realizan actos heroicos en su vida cotidiana.

28. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

29. Ang sugal ay isang hindi makabuluhang pamumuhunan na madalas nawawala ang ininveste.

30. Some scissors have adjustable tension screws that allow users to customize the tightness of the blades.

31. A couple of coworkers joined me for lunch at the cafe.

32. Honesty is the best policy.

33. La labradora de mi vecino siempre se emociona cuando ve a alguien llegar a casa.

34. Gigising ako mamayang tanghali.

35. Pagkaraan ng ilang araw ay magaling-galing na si Aling Rosa.

36. El diseño inusual del edificio está llamando la atención de los arquitectos.

37. Ang pagiging malilimutin ni Leah ay dala ng labis na pagkaabala sa trabaho.

38. Hindi ko alam kung paano ito tingnan, kaya sa ganang iyo, ano ang tunay na halaga ng pera?

39. The team lost their momentum after a player got injured.

40. Tsuper na rin ang mananagot niyan.

41. La poesía de Neruda tiene una elegancia sublime que conmueve al lector.

42. Ipinakita ng albularyo ang kanyang halamang gamot na ginagamit niya sa pagpapagaling.

43. Ang pag-asa ay nagbibigay ng inspirasyon sa mga tao upang magbigay ng tulong at suporta sa ibang tao.

44. They admire the way their boss manages the company with fairness and efficiency.

45. The team is working together smoothly, and so far so good.

46. Lahat ay nakatingin sa kanya.

47. Ang sinabi ng Dakilang Lumikha ay natupad.

48. Ano-ano pa po ang mga pinaggagagawa ninyo?

49. They are often served with a side of toast, hash browns, or fresh greens.

50. Si Ana ay humanga sa disenyo ng saranggola ng kanyang kuya.

Recent Searches

pangalanhigh-definitionefficientnakakaakitconnectiondumilimdalawampumagpa-checkuppublishedoutlinekakilalafalladilavetobawapilingmarieldelafuncionarfonosbinigyanglever,unfortunatelytinginallowsknow-howmakilingtechnologicallabing-siyamdingdingpoonstudiedconsideredbisigemocionesrecordedkinukuyommaliliitsapatosalituntunininfluencepresence,didkanikanilanglargokagubatanmahalagaincomekayadesarrollarpamamalakadorugaparingfinishednatulogsinafactoresilanganunventapinangalananbuhawinewsoundmaitimpakelamtenderginangdasalmulighederdumaramiilingeducationalenergynakadapabakereaderspasasalamatsigurosumarapmaalogmahigithugiskaniyapananakitstreetkaninoactualidadbayangrolandnamumulaklakiwinasiwasnahigitanhawlaalintuntuninrenacentistaendvidereorderintransportationelenamikaelaavailablekagayarelevantjudicialbossmagbunga1973tigasyoutubenaiisiptinayanak-pawisbumigaymatikmanbinibilangmirarosenakatirah-hoyparusahankalayuandemocraticmayamangnasulyapanbarohihigitcaracterizabahagyanghastamapapakausapinmaghilamosyelonilulonmakaiponblueimprovesinusuklalyantuktokritonakayukoreaksiyontunaynagsusulatisasagotdilagnagmamadalidyanpahiramwasakdiagnoseskamatistinaganaramdamannakakapuntamakahingiasulrolledmakukulaypaghuhugasproducirnanghahapdicertainlimoslockdownpagkakamalisinampalnatingalanunonapakalusogmaputipamagatbackpackkatabingadditionpdalutuinsourceslikelycountlesstumawatipidpromiserektangguloresourcesauthorpagkakalutorosaboypagkakapagsalitanutrientesescuelasautomatisereconsiderarpasosbarcelonacharismatictindahannagtatampo