Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

39 sentences found for "high-definition"

1. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

2. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

3. Electron microscopes use a beam of electrons instead of light to create high-resolution images of small objects.

4. High blood pressure can be managed effectively with proper medical care and self-care measures.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. High blood pressure can often be managed with a combination of medication and lifestyle changes.

7. High blood pressure is more common in older adults and those with certain medical conditions.

8. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

9. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

10. Kailan siya nagtapos ng high school

11. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

12. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

13. Mi temperatura es alta. (My temperature is high.)

14. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

15. Omelettes are a popular choice for those following a low-carb or high-protein diet.

16. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

17. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

18. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

19. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

20. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

21. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

22. Stress can be a contributing factor to high blood pressure and should be managed effectively.

23. The bandwidth of an oscilloscope determines its ability to accurately capture and display high-frequency signals.

24. The car's hefty engine allowed it to accelerate quickly and reach high speeds.

25. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

26. The doctor measured his blood pressure and diagnosed him with high blood pressure.

27. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

28. The king's court is the official gathering place for his advisors and high-ranking officials.

29. The laptop's hefty price tag reflected its powerful specifications and high-end features.

30. The medication helped to lower her high blood pressure and prevent complications.

31. The nurse checked her blood pressure and noted that it was slightly elevated, indicating the possibility of high blood pressure.

32. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

33. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

34. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

35. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

36. The patient's family history of high blood pressure increased his risk of developing the condition.

37. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

38. Up above the world so high

39. Up above the world so high,

Random Sentences

1. Las personas pobres merecen ser tratadas con respeto y compasión, no con desdén o indiferencia.

2. Dahil malilimutin ang bata, iniwan niya ang kanyang takdang-aralin sa bahay.

3. Laganap ang fake news sa internet.

4. Los powerbanks con tecnología de carga rápida pueden cargar los dispositivos más rápido que los cargadores convencionales.

5. Matagal akong nag stay sa library.

6. Kailangang salatin mo ang tela para malaman kung gaano ito kalambot.

7. Ayaw siyang pagawain sa bahay at sustentado siyang mabuti sa pagkain.

8. What goes around, comes around.

9. Kumain kana ba?

10. Las serpientes tienen una mandíbula flexible que les permite tragar presas enteras, incluso si son más grandes que su propia cabeza.

11. Jennifer Aniston gained fame for her role as Rachel Green on the television show "Friends."

12. Nakatira si Nerissa sa Long Island.

13. Ang haba ng prusisyon.

14. Datapwat mali sila ng akala, sapagkat ang anak ay hindi nagbago.

15. Las heridas por quemaduras pueden necesitar de tratamientos específicos, como el uso de cremas o apósitos especiales.

16. ¿Cómo has estado?

17. Nakatayo ang lalaking nakapayong.

18. Marami siyang kaibigan dahil palangiti siya.

19. La paciencia es clave para alcanzar el éxito.

20. La realidad puede ser sorprendente y hermosa al mismo tiempo.

21. Los agricultores a menudo trabajan en estrecha colaboración con otros miembros de la cadena alimentaria, como los transportistas y los minoristas.

22. Inirekumenda ng guro na magsagawa kami ng mga field trip upang mas mapalawak ang aming kaalaman.

23. Many wives have to juggle multiple responsibilities, including work, childcare, and household chores.

24. Instagram Stories is a feature that lets users share temporary photos and videos that disappear after 24 hours.

25. Hospitalization can range from a few hours to several days or weeks, depending on the nature and severity of the condition.

26.

27. Samantala sa malayong lugar, nagmamasid siya ng mga bituin sa kalangitan.

28. Actions speak louder than words.

29. However, concerns have been raised about the potential impact of AI algorithms on jobs and society as a whole.

30. Nakinig ang mga estudyante sa guro.

31. Paano ho ako pupunta sa Palma Hall?

32. Ang poot ay maaaring maging mapaminsalang puwersa kapag hindi ito naayos nang maayos.

33. Drømme kan være en kilde til inspiration og kreativitet.

34. Puedes saber que el maíz está maduro cuando las hojas inferiores comienzan a secarse y las espigas están duras al tacto

35. Ang mahiwagang pagsagot ng prinsipeng tila ba mag agam-agam.

36. The model on the runway was a beautiful lady who effortlessly commanded attention.

37. Ang maliit na mesa ang nasa kuwarto.

38. Hiramin ko muna ang iyong libro para magkaruon ako ng kopya nito.

39. Hindi ka nag-iisa, mayroon kang kaulayaw na handang tumulong sa iyo.

40. Ang pagsunod sa regular na oras ng pagtulog ay mahalaga upang mapanatili ang maayos na gising.

41. Hindi ka ba papasok? tanong niya.

42. Mahirap magtiis kung mahal mo sya.

43. The director shouted "break a leg!" as we went onstage.

44. Medarbejdere kan arbejde på fuld tid eller deltidsbasis.

45. That article might not be completely accurate, so take it with a grain of salt.

46. Ibinigay niya ang kanyang pera para matugunan ang mga pangangailangan ng komunidad.

47. The artist painted a series of landscapes inspired by her travels.

48. Pero pag harap ko, para akong nanigas sa kinatatayuan ko.

49. Les examens et les tests sont des évaluations importantes pour les étudiants.

50. Hiramin mo ang aking payong dahil umuulan ng malakas.

Recent Searches

high-definitionbalathundredpulispitumpongfulfillingcharismaticwasteumakyatvivafatherangalmatulogtrenyataiilanhdtvsamakatwidtaassinkhousealexanderlandepopularmanuksoexhaustedtelangelitesweetwestnatanggapiskodiamondisipminutobusloabrilsiemprekadaratingunti-untingcompartenballsumakitelectionslaborlabingeveningstonehamparagraphscardcriticspitakamatapangnyoactivityaddconsiderarelectronicpinunitfistsdaigdigteamfuncionarlastinglibreleenutrientesdumatingtypesfutureoftenmarkedautomaticcontrolaincreasedferrernothingstoplightnaggingupworkcrazyuniversitybio-gas-developinginfusionespinadalagayunpamangasolinahanpangalanhaftpangakomontrealairportbutmaglabanagsilapitrepublicmasinoptennisasahanyumuyukonakaka-innakuhangdi-kalayuandinalanapapatungokinauupuanmagasawangaanhinginugunitarenombremagnakawnakabulagtangkumbinsihinmagpaniwalalaki-lakikalalakihannanangiskumalmachessrecentlyformasnangangakopamumunonagagamitbalediktoryantahananparapresidentepandidiritinakasanricamahinamagdamaganmakakabalikbwahahahahahaaplicacioneshouseholdstinutopkanikanilangnaiilagantatagalmaipagmamalakingnahihiyangmanghikayatdoble-karanagcurvesinasadyakamakailandahan-dahanpronounhigantenasasaktanevolucionadomasaktangawinestasyonsagutinpagbigyanfactoresnagsinestoryisinagotkamandagnapasubsobenviarheypagdiriwangsiyudadnanamanhinalungkathistoriamensemocionesnatinagtutusingelaimahalbayadinhalemasaganangbibilhinvariedadbayaningcompletamenteengkantadagroceryhihigitumabotsumasakaylalimmoneysisentaendvidereobservation,tulogbaryomayamangphilippinetsssyey