Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "goodevening"

1. Goodevening sir, may I take your order now?

Random Sentences

1. Bakit ka natawa? Bakit ka nakangiti?

2. Nagmumukha siyang Intsik-beho kapag suot iyon ngunit wala naman siyang maraming kamisetang maisusuot.

3. A lot of rain caused flooding in the streets.

4. Siempre es gratificante cosechar las verduras que hemos cultivado con tanto esfuerzo.

5. She was worried about the possibility of developing pneumonia after being exposed to someone with the infection.

6. Ang buhawi ay maaaring magdulot ng matinding pagkasira sa kagubatan at kapaligiran dahil sa malakas na hangin at pag-ulan.

7. Sa kabila ng kanyang tagumpay, may bahid ng lungkot sa kanyang mga mata.

8. Omelettes are a popular choice for those following a low-carb or high-protein diet.

9. También es conocido por la creación de la Capilla Sixtina en el Vaticano.

10. Habang maliit pa ang bata ay itinuro na ng mag-asawa kung paano ang humabi.

11. Bibili rin siya ng garbansos.

12. It is important to take breaks and engage in self-care activities when experiencing frustration to avoid burnout.

13. John Quincy Adams, the sixth president of the United States, served from 1825 to 1829 and was the son of the second president, John Adams.

14. Hinanap niya ang dalaga sa buong kagubatan ngunit hindi niya nakita.

15. Pagkatapos maligo, ang katawan ay nagiging mabango at malinis sa amoy.

16. Si Maria ay malakas ang boses, bagkus ang kanyang kapatid ay tahimik.

17. Natapos mo na ang proyekto mo? Kung gayon, maaari ka nang magpahinga.

18. Instagram also offers the option to send direct messages to other users, allowing for private conversations.

19. He was advised to avoid contact with people who had pneumonia to reduce his risk of infection.

20. Women have often been the primary caregivers for children and elderly family members.

21. Effective representatives possess strong communication, leadership, and negotiation skills to effectively represent their constituents' interests.

22. L'auto-discipline est également importante pour maintenir la motivation, car elle permet de s'engager dans des actions nécessaires même lorsque cela peut être difficile.

23. Mahirap kalabanin ang sakit na nagdadala ng agaw-buhay na pakikibaka.

24. I met a beautiful lady on my trip to Paris, and we had a wonderful conversation over coffee.

25. Nasaktan, nagalit din ang lola at gumanti.

26. Kailangan na nya makuha ang resulta ng medical exam bukas.

27. Cancer is a leading cause of death worldwide, and millions of people are diagnosed with cancer each year.

28. Nasa likuran lamang niya ang nagsalita.

29. Nagagandahan ako kay Anna.

30. He has bought a new car.

31. The United States is home to some of the world's leading educational institutions, including Ivy League universities.

32. Cybersecurity measures were implemented to prevent malicious traffic from affecting the network.

33. My brother and I both love hiking and camping, so we make great travel companions. Birds of the same feather flock together!

34. The United States is a culturally diverse country, with a mix of ethnicities, languages, and religions.

35. The bakery offers a wide variety of cakes, from classic flavors to unique creations.

36. Está claro que la evidencia respalda esta afirmación.

37. Arbejdsgivere leder ofte efter erfarne medarbejdere.

38. Every year, I have a big party for my birthday.

39. Palaging nagtatampo si Arthur.

40. Doa juga dapat dijadikan sarana untuk memohon perlindungan dan keberkahan dari Tuhan.

41. Sino ba talaga ang tatay mo?

42. La science de la météorologie étudie les phénomènes météorologiques et climatiques.

43. Ayaw siyang pagawain sa bahay at sustentado siyang mabuti sa pagkain.

44. Si Padre Abena ang gusting umampon kay Tony at gusto rin niyang pag-aralin ito

45. Huwag kayo maingay sa library!

46. I forgot my phone at home and then it started raining. That just added insult to injury.

47. Nagalit ang matanda at pinalayas ang babaeng madungis.

48. The acquired assets included several patents and trademarks.

49. Gumanda ka lalo sa kulay ng suot mo.

50. Madamot ang matanda tuwing may pupunta sa kanyang tahanan upang humingi ng tulong, agad niyang pinalalayas ang mga ito.

Recent Searches

nerogoodeveningbeginningstrenmaaariparangkinsehetohigh-definitionrosellemayamansumasakittodolayout,misusedsumamabriefdalandandollymaskfeedback,terminoshowswestgawaiwanandeathintroducetransitduripersonalasindyanschoolsspecialhamakdisappointaccuracybilanginbookstipdivisiontutorialserrors,learningshifttopicwhetherpaceinvolvepilingpuntaelectronicsipaglossprimerboyfriendkadaratingtemperaturaconcernsminamasdanbabalikistasyonambisyosangbilugangeitherdespuestalagangpagiginginteligentesflightsinapakpinangalanangperatomprogresso-orderpagsalakayvictoriadospotentialmaayosibalikpalagaymagbalikawardwarirecentliligawanlayuninpulubisalbahengkatawansalbahekuripotkalikasankargahanpumulotmanghikayatwaitermusiciancountrypunong-kahoyhonestoadvertisingartificialpinatirasana-alltermnakilalapagtangohinaboltanyagcandidatesasagotagilasundaelipatstudieddiligintilajunjunneed,tanawinalignshinihilingadmiredkatagangtulungannagawangtiyanuntimelybutdrawinguugud-ugodmalungkotdahan-dahanayudanakikisalosapatmartialculturasnagwo-workharisunud-sunodmorenaniwalatonightcompanynagsagawaoperativoshuertomayakahitkabuhayanpalabuy-laboyonlinethreeagam-agamkanyaviewsabundantedahanpanaymaskinertagtuyotdumilathidingdeclaregoodnami-missmagpagalingputingsumagotmapakaliiiwasanmedidapakinabanganpagdudugohuludoingkunwamaliitkinasuklamanpumitasaminnatanongmaratingmakikipag-duetowalamateryalesbook:pinagkasundonakalockkakahuyanlalakilabinsiyammakawalaharapancnico