Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

15 sentences found for "between"

1. A successful marriage often requires open communication and mutual respect between a husband and wife.

2. Cheating is not always intentional and can sometimes occur due to a lack of communication or understanding between partners.

3. Einstein's most famous equation, E=mc², describes the relationship between energy and mass.

4. Football games are typically divided into two halves of 45 minutes each, with a short break between each half.

5. He sought to strengthen border security and pushed for the construction of a border wall between the United States and Mexico.

6. Hockey games are typically divided into three periods of 20 minutes each, with a short break between each period.

7. Mathematics provides a universal language for communication between people of different cultures and backgrounds.

8. Nationalism can be a source of conflict between different groups within a nation-state.

9. Nationalism has been an important factor in the formation of modern states and the boundaries between them.

10. The disagreement between them turned out to be a storm in a teacup.

11. The first dance between the bride and groom is a traditional part of the wedding reception.

12. The relationship between work and mental health is complex and can vary from person to person.

13. The United States has a system of federalism, where power is divided between the national government and the individual states

14. The United States is a federal republic, meaning that power is divided between the national government and the individual states

15. They act as a bridge between their constituents and the government, conveying concerns and advocating for necessary reforms.

Random Sentences

1. Gaano katagal ako maghihintay sa bus?

2. Ang republika na itinatag niya ang unang demokratikong republika sa Asya.

3. If you want to secure a good seat at the concert, you have to arrive early - the early bird gets the worm.

4. Transkønnede børn og unge skal have adgang til støtte og ressourcer til at udforske deres kønsidentitet i en tryg og støttende miljø.

5. Wala kang dalang payong? Kung gayon, mababasa ka ng ulan.

6. Oh gosh. Inintay pa sya ng prince, what does it mean?

7. Naabutan niya ito sa bayan.

8. Bumibili ako ng maliit na libro.

9. Hitik na hitik sa bunga ang nasabing puno.

10. Siya ay hinugot ng mga pagsubok sa buhay ngunit hindi siya sumuko.

11. Isang araw, napagod na ang mga diwata sa away ng mga mababangis na hayop at mga ibon.

12. Tumulo ang laway niya nang nakita niya ang pinaka-masarap na kakanin na inihain sa kanya.

13.

14. Les encouragements et les récompenses peuvent être utilisés pour motiver les autres, mais il est important de ne pas les rendre dépendants de ces stimuli.

15. Las heridas profundas o que no dejan de sangrar deben ser evaluadas por un profesional médico.

16. Maaliwalas ang paligid sa bukid tuwing madaling araw

17. Hindi dapat magpakalugi sa pagpapautang dahil ito ay nagdudulot ng financial loss.

18. Kapitbahay ni Armael si Juang malilimutin.

19. Elle adore les films d'horreur.

20. They have been creating art together for hours.

21. Bago niya napanalunan ang ginto, si Hidilyn Diaz ay nagwagi na ng pilak na medalya sa Rio Olympics 2016.

22. All is fair in love and war.

23. Napaiyak si Aling Pising ng makita ang mga tuyong kahoy at posporo sa ilalim ng kanilang bahay.

24. D'you know what time it might be?

25. La música es una forma de arte que ha evolucionado a lo largo del tiempo.

26. Las escuelas privadas requieren matrícula y ofrecen diferentes programas educativos.

27. Limitations can be a source of motivation to push oneself to achieve more.

28. Sa kabila ng mga pagsubok, hindi siya sumusuko at pinagsisikapan na mapabuti ang kanyang buhay.

29. Transkønnede personer har ret til at udtrykke deres kønsidentitet uden frygt for vold eller diskrimination.

30. Muchas personas luchan con la adicción a las drogas y necesitan ayuda para superarla.

31. Nag-aaral ka ba sa University of London?

32. At blive kvinde handler også om at udvikle sin personlighed og identitet.

33. Mahilig sya magtanim ng mga halaman sa kanilang lugar.

34. Foreclosed properties may have liens or other encumbrances, which can complicate the purchase process.

35. Road construction caused a major traffic jam near the main square.

36. Elektronisk udstyr kan hjælpe med at forbedre effektiviteten og produktiviteten af ​​virksomheder.

37. Les enseignants peuvent encadrer des clubs étudiants pour promouvoir les compétences sociales et artistiques des élèves.

38. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

39. Los héroes pueden ser tanto figuras históricas como personas comunes que realizan actos heroicos en su vida cotidiana.

40. Sa paligid ng balde, nakikia niya ang kanyang anino.

41. The weather is holding up, and so far so good.

42. Nagliliyab ang puso ni Andres sa pagmamahal para sa kanyang pamilya.

43. "Ang batang matalino, may alam sa lahat ng bagay" ay isang bukambibig na nagpapahayag ng husay at talino ng isang batang may malawak na kaalaman.

44. Wala akong pakelam, basta nasa ref ng bahay ko akin!

45.

46. Det har også ændret måden, vi producerer ting og øget vores evne til at fremstille emner i større mængder og med højere præcision

47. I just got around to watching that movie - better late than never.

48. The host introduced us to his wife, a beautiful lady with a charming personality.

49. La realidad es a menudo más compleja de lo que parece.

50. The culprit who stole the purse was caught on camera and identified by the victim.

Recent Searches

eithermediumvanevolvebetweencallingmenualaalanagpapaigibrevolucionadopaki-translatenagpapakainikinamatayisinulatentrancestopagtutolpangyayarinagcurvesunud-sunurankubyertoscancersulyappinasalamatannakabawiisinalangtumamainilistahayaanmagbantaymauupojulietganapinletmaaksidentelasanandiyannagisingbumabahaparkenatanggapspareinomoutlinesdarkneromapcirclenagtatakbonakakitamagsalitapakikipagtagpopoliticalmagpa-picturenakakapagpatibayespanyolpagbatimayumingtig-bebeintekabutihankinasisindakanuugod-ugodhandaanguitarramagpalagopagdudugonalakipangangatawanmahinangnandayaairportlalakikahulugantravelmaipagmamalakingumiinomsharmaineperseverance,kumembut-kembotmapakalimagagawamagulayawkalalarominamahalpagtataashiwapaki-drawingh-hoynagpepekepaglalabadamag-aaralnakayukonaiyakhampaslupasaritapagdukwangpamahalaankarununganakongpandalawahankinagalitansabadongnalalabinagpalalimnagkakakainnakakapasoklumalakipaglalayagmakikipagbabagkalakihanpagngititinulak-tulakpagpapatubopagkakayakapnanlilimahidnagmungkahimakauuwiiyongrinspanlolokopagsuboklalabhanngumingisiintindihinnagdabognakatitigsinaliksikhayaangtotoongnami-misspagkuwanmagsugalpinapatapospagkainistangeksmensahengumiwigumawacualquiernagbentacultivationnamumulaibinaonpaparusahannamuhayskirtmagagamitdispositivokuwentobowlkumirotmagsunoglot,sasakaytennissanganewshawakngitipagbibirobinuksankastilanggawainnagsilapitpaulit-ulitregulering,pakakasalantumatawadtinungocountrymarketing:plantasininomhinamakpumikitlumiitsakalingbirthdaytalinoincitamenterpantalonnagpasamabintanapwedengdecreasedpakibigyannasilawbihirangpaglingonmagisippangalananbaronggawasampungtaksibasketballmassachusettsherramientasnauntogroofstock