Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

15 sentences found for "between"

1. A successful marriage often requires open communication and mutual respect between a husband and wife.

2. Cheating is not always intentional and can sometimes occur due to a lack of communication or understanding between partners.

3. Einstein's most famous equation, E=mc², describes the relationship between energy and mass.

4. Football games are typically divided into two halves of 45 minutes each, with a short break between each half.

5. He sought to strengthen border security and pushed for the construction of a border wall between the United States and Mexico.

6. Hockey games are typically divided into three periods of 20 minutes each, with a short break between each period.

7. Mathematics provides a universal language for communication between people of different cultures and backgrounds.

8. Nationalism can be a source of conflict between different groups within a nation-state.

9. Nationalism has been an important factor in the formation of modern states and the boundaries between them.

10. The disagreement between them turned out to be a storm in a teacup.

11. The first dance between the bride and groom is a traditional part of the wedding reception.

12. The relationship between work and mental health is complex and can vary from person to person.

13. The United States has a system of federalism, where power is divided between the national government and the individual states

14. The United States is a federal republic, meaning that power is divided between the national government and the individual states

15. They act as a bridge between their constituents and the government, conveying concerns and advocating for necessary reforms.

Random Sentences

1. Huwag na sana siyang bumalik.

2. Baby fever can impact relationships, as partners may have different timelines or desires regarding starting a family.

3. Inflation kann auch durch eine Erhöhung der Steuern verursacht werden.

4. When I'm feeling nervous about networking, I remind myself that everyone is there to break the ice and make connections.

5. Matanda na ang kanyang mga magulang at gumagamit na ang mga ito ng diaper.

6. El movimiento del baile contemporáneo tiene una elegancia sublime que conmueve al espectador.

7. Kapareha naman ni Kangkong ang Sitaw, ni Mangga ang Dalanghita, ni Saging ang Papaya.

8. Ano ang ginagawa ni Trina tuwing Mayo?

9. Nasa kuwarto po siya. Sino po sila?

10. El amor todo lo puede.

11. Agama menjadi salah satu faktor yang menguatkan identitas nasional Indonesia dan menjaga kesatuan dalam ker

12. Doa sering kali dianggap sebagai bentuk ibadah yang penting dalam agama dan kepercayaan di Indonesia.

13. Angelina Jolie is an acclaimed actress known for her roles in films like "Tomb Raider" and "Maleficent."

14. La tos puede ser un síntoma de afecciones menos comunes, como la sarcoidosis y la fibrosis pulmonar.

15. Pwede ko ba makuha ang cellphone number mo?

16. The backpacker's gear was hefty, but necessary for their long trek through the wilderness.

17. Robusta beans are cheaper and have a more bitter taste.

18. He used credit from the bank to start his own business.

19. The first dance between the bride and groom is a traditional part of the wedding reception.

20. Napangiti ako bigla. Yun lang ba yung problema niya?

21. Camarón que se duerme, se lo lleva la corriente. - You snooze, you lose.

22. Emphasis can be used to provide clarity and direction in writing.

23. The flowers are not blooming yet.

24. Maaari po bang makahingi ng sobra sa hapunan ninyo?

25. Nanatili siya sa pagkakatayo nang ilang saglit, wari'y tinakasan ng lakas, nag-iisip ng mga nakaraang pangyayari.

26. Cinderella is a tale of a young girl who overcomes adversity with the help of her fairy godmother and a glass slipper.

27. Uncertainty can create opportunities for growth and development.

28. Sa takot ng mga tao sa pagsalakay ng mga tulisan, ibinaon nila ang gong sa isang lugar na malapit sa gubat.

29. Ilang kuwarto ho ang gusto niyo?

30. Kumanan kayo po sa Masaya street.

31. The company is exploring new opportunities to acquire assets.

32. Napaiyak si Aling Pising ng makita ang mga tuyong kahoy at posporo sa ilalim ng kanilang bahay.

33. Sumimangot ako at humarap ulit sa labas.

34. Microscopes are used to study cells, microorganisms, tissues, and other small structures.

35. It's wise to compare different credit card options before choosing one.

36. Ang ilalim ng kanyang payong ay nagsilbing lilim mula sa malakas na sikat ng araw.

37. Omelettes are quick and easy to prepare, making them a convenient meal option.

38. Nagtapos siya sa kolehiyo noong 1990.

39. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

40. I discovered a new online game on a gaming website that I've been playing for hours.

41. Malamig na pawis ang gumigiti sa kanyang noo at ang tuhod niya ay parang nangangalog.

42. Palagi sya nagbibigay ng pagkain sa pulubi.

43. Ofte bliver helte hyldet efter deres død.

44. She burned bridges with her friends by spreading gossip about them.

45. Napatingin yung 7 na babaeng classmate namin na naguusap.

46. Kagyat na bumaha ang nakaliliyong dilim sa kanyang utak.

47. Ngumiti lang siya saken bilang sagot.

48. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

49. Maging ang mga mahihirap na disenyo ay kaya ng gawin ng bata sa murang edad.

50. When in Rome, do as the Romans do.

Recent Searches

betweenboyfriendkuwadernorailtanghalitaxihabitmalakidigitalmawalanakaluhodbighanisiguradomaanghanglahatnakapaligidpahingabyggetpangyayarihimutokfestivalnakapikitabutannakatagokilaynagpanggapnakitulognungdyanmahabolanaysakupinhojasnagagamitwriting,ipipilityoungtablediyosmakulitbagkus,paanopahingalasukalthoughtsiligtasbaleginangkatutubokumainwalangtsinatalinonaiiritangumiisodbasalinawnatatawangsaringkumukulopuntahangasreloopisinaotherscestuloymasasalubongmagbakasyoncurrentfavorlefttinangkainiirogpanahonnagsagawakaramdamanmasasayamaninipishumiwaselakinikitamakikipagbabagibotocorrectingnapapikitbeinganiyasinanageespadahanpamilyamagtanghalianmamarilalas-diyeskotsengandamingcoursesmangungudngodgagamitthemtugonnakamititaassawastatusmalagogisingnaglaroempresaskuwartobathalawhilenamumutlanagyayanglakingkanginamagdoorbellmaasimtinulak-tulakkapetatawagsitawikukumparamakapagbigaytvsbisigsinabiendingnapatinginisinagotpaanongnakakapuntanutrientesuncheckedginisingipihitbawianmaisusuotkonsyertopalabasketkoronanamingfrogkaninoinantaymatatalopag-aaralchoosedagokbumangonpag-irrigatereallymagkasing-edadasawasilyasakamasinoppodcasts,pasasaanpangingimiganoonnakakapagodmasyadongphonesumugodsilafarmre-reviewmurang-muranatagalaneksenanyosinagotpagkakayakaphigh-definitiongalake-booksnagbasabumahatradisyonluisasamakatwidalas-dosenagpapasasakikitanagbentahahahajustnatapakanattorneydeallabinghinagpisnatatawapapaanomissionnatalongyumabongkisapmata