Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

15 sentences found for "between"

1. A successful marriage often requires open communication and mutual respect between a husband and wife.

2. Cheating is not always intentional and can sometimes occur due to a lack of communication or understanding between partners.

3. Einstein's most famous equation, E=mc², describes the relationship between energy and mass.

4. Football games are typically divided into two halves of 45 minutes each, with a short break between each half.

5. He sought to strengthen border security and pushed for the construction of a border wall between the United States and Mexico.

6. Hockey games are typically divided into three periods of 20 minutes each, with a short break between each period.

7. Mathematics provides a universal language for communication between people of different cultures and backgrounds.

8. Nationalism can be a source of conflict between different groups within a nation-state.

9. Nationalism has been an important factor in the formation of modern states and the boundaries between them.

10. The disagreement between them turned out to be a storm in a teacup.

11. The first dance between the bride and groom is a traditional part of the wedding reception.

12. The relationship between work and mental health is complex and can vary from person to person.

13. The United States has a system of federalism, where power is divided between the national government and the individual states

14. The United States is a federal republic, meaning that power is divided between the national government and the individual states

15. They act as a bridge between their constituents and the government, conveying concerns and advocating for necessary reforms.

Random Sentences

1. Zachary Taylor, the twelfth president of the United States, served from 1849 to 1850 and died while in office.

2. Kailangan mong higupin ang gamot gamit ang straw.

3. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

4. Nakapaglaro ka na ba ng squash?

5. Ada banyak komunitas pecinta kucing di Indonesia yang berkumpul untuk berbagi pengalaman dan pengetahuan tentang kucing.

6. Oh.. hindi ko alam ang sasabihin ko.

7. Ang Datu ay nalungkot at nawalan ng lakas na harapin ang katotohanan.

8. Kapag tag-araw ay malaki-laki rin ang kinikita ng mga agwador.

9. Magdamag kong naiwang bukas ang ilaw.

10. H-hindi na sabi eh! inis na sabi nya.

11. Software er også en vigtig del af teknologi

12. Ang utang ay maaaring maging mabuting paraan upang matugunan ang mga pangangailangan sa panahon ng kawalan ng sapat na pera.

13. Nag merienda kana ba?

14. Pinagtatalunan nila kung sino ang mas may karapatang manirahan sa malago at mayamang kagubatan.

15. Ang talambuhay ni Emilio Jacinto ay nagpapakita ng kanyang kabataan at ang kanyang kontribusyon sa rebolusyon.

16. Nakipagtagisan sya ng talino sa kapwa estudyante.

17. Lazada has partnered with local brands and retailers to offer exclusive products and promotions.

18. También cuentan con pantallas táctiles y una gran cantidad de memoria interna para almacenar información, fotos, videos y música

19. I am absolutely excited about the future possibilities.

20. Sinakop ng mga espanyol ang Pilipinas nang mahigit sa 300 years.

21. When I arrived at the book club meeting, I was pleased to see that everyone there shared my love of literary fiction. Birds of the same feather flock together indeed.

22. Writing a book is a long process and requires a lot of dedication and hard work

23. Naglinis kami ng bahay noong Linggo.

24. What goes around, comes around.

25. Ang Biyernes Santo ay pagluluksa.

26. Eine schwere Last auf dem Gewissen kann uns belasten und unser Wohlbefinden beeinträchtigen.

27. Amazon's Alexa virtual assistant is integrated into many of its products, including the Echo smart speaker.

28. Marahil ay malamig ang klima sa bundok sa panahon ngayon.

29. Different types of work require different skills, education, and training.

30. Aku sayang kamu lebih dari apapun, sayang. (I love you more than anything, darling.)

31. Isang mahahalagang pag-uusap o tagpo ang naganap sa loob ng kabanata, na nagbibigay ng bagong pag-unawa sa mga karakter.

32. Limitations can be a result of geographic location or access to resources and opportunities.

33. Vous parlez français très bien.

34. Ang mga puno at halaman ay nag po-produce ng oxygen.

35. Mathematics can be both challenging and rewarding to learn and apply.

36. Lumago ang halaman, yumabong ang sanga hanggang sa ito'y namulaklak at namunga.

37. El amor todo lo puede.

38. Laging kinatatakutan si Kablan sa pagiging usurero sa Palawan, ang pating naman ay lagi ring kinasisindakan sa kabangisan.

39. Ano ang ginawa niya pagkatapos ng giyera?

40. Uno de mis pasatiempos favoritos es leer novelas de misterio.

41. Though I know not what you are

42. Nawala yung antok ko. May pumasok na evil plan sa utak ko.

43. Napansin ni Rabona na kumakapal ang buhok nito sa katawan.

44. La belleza natural de la cascada es sublime, con su agua cristalina y sonidos relajantes.

45. Algunas serpientes, como la cobra real y la serpiente de cascabel, son conocidas por sus capacidades defensivas y sus venenos letales.

46. Ang mga mangingisda ay nagtatanim ng mga alon sa kanilang pagmamahal sa karagatan.

47. La tos aguda dura menos de tres semanas y generalmente se debe a una infección viral.

48. Some businesses and merchants accept cryptocurrency as payment.

49. Hinde kasi ako mapakali kaya pumunta ako dito.

50. Nagsusulat ako ng mga pangaral at talumpati para sa mga okasyon sa paaralan.

Recent Searches

roughbetweenmakespackagingpinagalitanbiglangkinasisindakanpulang-pulanamanghaaniawitanpusopananakotumakyatnag-replyaboinaabotnakahugrosariomagalingpanalopersonskakaibasystems-diesel-runnagkakasayahanrealkalalakihanculturalpagkabuhaypatutunguhannagkasunogpaldasinasadyabumisitafollowing,sparepagkasabikuwadernopagtutolnakatagolabisnyasalbahengsasakyantumawakisssuedeklasrumtoretenagwalisnapabalitagumalacirclecausespangakoblendtransportmidlerproducerertaglagasumigtadkampanaproducts:pinakamasayabukatumahimiksumpainspeechsinusuklalyanshopeeincrediblemagpakaramiisinamana-curiousproductspinakamatabangpasalamatanhappierpananakitpagpapatubopagkalitophilippinerememberedsalatinhumabolnapalitangnapakabangonapaaganagpapaigibtelefonenergimatigasmuyangalmaistorboisinusuotinsektoibabahistorydressbateryabarreraspsssnakatoysalataumentaractivitypopularizefuelgoalbestlinawtoothbrushplaceomelettecivilizationdiamondmentalnowsusunduinespadamoodkalupiprusisyonbackstylesumilingmichaelposterpuedescharitablespecificregularmenteelectednatinglutosonidocebuhinintaylumisantanghalipagkakapagsalitapag-aapuhapdinaluhannagcurvedaanbirthdaynagawangbayaranangkingsensiblenagsinepaghakbangsarilieksamennaidlipmagkabilangtengamalikotpulaadabarcelonaalignslibrebantulotadditionallyauditpagbahingfacilitatingeditorbangsakinpasasalamatyumaonapasubsobnagwagimagandangkagipitantuwangpagkakayakapbinawianumabotnaglulusakunanyunmagkasintahannagsisipag-uwiannakakatulongkatawangtreatssalegraphickinauupuangpapagalitankasamahantinawagmatiyakininomtinakasannakaraan