Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "diagnostic"

1. The development of vaccines and antibiotics has greatly reduced the incidence of infectious diseases, while the use of medical imaging and diagnostic tools has improved the accuracy and speed of diagnoses

Random Sentences

1. When we forgive, we open ourselves up to the possibility of reconciliation and rebuilding damaged relationships.

2. Pakibigay ng malakas na palakpak ang lahat para sa ating mga guro.

3. Ang presidente ng Pilipinas ay nagpabot na ng ayuda sa mga mahihirap.

4. Anong oras nagbabasa si Katie?

5. When in Rome, do as the Romans do.

6. Ang pag-asa ay nagbibigay ng kahulugan sa buhay ng mga tao sa pamamagitan ng kanilang mga pangarap at mga layunin.

7. Ang sugal ay naglalayo sa mga tao sa kanilang mga responsibilidad at mga mahahalagang gawain sa buhay.

8. Magsuot ka palagi ng facemask pag lalabas.

9. Cancer is a leading cause of death worldwide, and millions of people are diagnosed with cancer each year.

10. Naglipana ang mga bulaklak sa hardin dahil sa maayos na pag-aalaga.

11. I find that breaking the ice early in a job interview helps to put me at ease and establish a rapport with the interviewer.

12. Cheating can occur in many forms, including physical infidelity, emotional infidelity, or both.

13. Maarte siya sa kanyang hitsura kaya lagi siyang nakabihis ng maganda.

14. Musk has been named one of the most influential people in the world by TIME magazine.

15. Pumasok ka na lang sa kwarto. Susunod na lang ako..

16. I don't want to go out in this weather - it's absolutely pouring, like it's raining cats and dogs.

17. Der er forskellige identiteter inden for transkønnethed, herunder non-binær og genderfluid.

18. Hindi ito maganda na maging sobrang takot sa lahat ng bagay dahil lamang sa agam-agam.

19. The zoo houses a variety of animals, including lions, elephants, and giraffes.

20. Ibinigay ni Ana ang susi kay Sally.

21. Naghanda kami ng sorpresa para sa kanya.

22. Nationalism has been used to justify imperialism and expansionism.

23. Børn har brug for at lære om kulturelle forskelle og respekt for mangfoldighed.

24. The concept of God has also been used to justify social and political structures, with some societies claiming divine authority for their rulers or laws.

25. Omelettes are a popular choice for those following a low-carb or high-protein diet.

26. L'intelligence artificielle peut aider à optimiser les processus de production industrielle.

27. The acquired assets were key to the company's diversification strategy.

28. Ano pa ho ang dapat kong gawin?

29. She lost her job, and then her boyfriend broke up with her. That really added insult to injury.

30. The church organized a charitable drive to distribute food to the homeless.

31. Los powerbanks pueden prolongar la duración de la batería de un dispositivo móvil cuando no hay acceso a una toma de corriente.

32. Party ni Lory? nabigla sya sakin sa sinabi ko.

33. Les hôpitaux peuvent être des endroits stressants pour les patients et leur famille.

34. Nagkagulo sa palengke at kumaripas ng takbo ang mga tao dahil sa maling akalang may sunog.

35. Nagbabakasyon ako sa beach kasama ang pamilya kaya masayang-masaya ako ngayon.

36. She has adopted a healthy lifestyle.

37. Transkønnede personer er mennesker, der føler sig som det modsatte køn af det, de blev tildelt ved fødslen.

38. Nag-aaral ka ba sa University of London?

39. Hinipan-hipan niya ang manipis na dibdib.

40. Ang masamang balita ay unti-unting naghatid ng kanyang damdamin palayo sa kasiyahan.

41. I don't want to spill the beans about the new product until we have a proper announcement.

42. Sa aking kasintahan, natatanaw ko ang pagmamahal na umaapaw sa kanyang mga mata.

43. Ako ay sobrang gutom, bagkus ako ay mag-aantay na lang ng hapunan mamaya.

44. Nagsisilbi siya bilang public servant upang matugunan ang pangangailangan ng kanyang nasasakupan.

45. Ano ang ikinamatay ng asawa niya?

46. Some viruses, such as the common cold and flu, can cause mild symptoms, while others, like HIV and Ebola, can be deadly.

47. Ang snob naman neto. Alam mo ba kung anong oras na?

48. Gaano kalaki ang bahay ni Erap?

49. Di na natuto.

50. Bakit mo siya binilhan ng kurbata?

Recent Searches

diagnosticredpitodonethroughoutneropierelectioncommunicationstvsmuchosiconpeepsamuuncheckedsinabitrasciendepaossheoverbinibiyayaanmakesnutsmakapilingeffectsleadpilingworkshopcirclehapasinnaroonipapainiteksambabaideavigtigniyanilaniconararapatmentalnicemungkahipondotanongsinigangnearmabaliknapamunacreatividadnerosmaglarojuangtenidomaritesmoodconenvironmentkapitbahaysumpainmagbibiladnagmasid-masidnapatayonagsuotforevermissmiramesamamimaislovekabilanglilylarolagikuyakongkabutihankerbkayakanokainpalamutijoseitimiskorepresentativesisipintoinitibonibigsabadohulihiyalarryhighhelehateguroperaganagabigabesilangfearsang-ayonkagalakannakasandigpagsusulatmagsi-skiinggumawasubalitmagpasalamatsinusuklalyanalapaapokayginawatuktoksigurorolandwasaksinimulaneleksyonimproveipinadalamaymanilbihanlumabaspeksmanculturasbalitagawinpaghangakinumutankidkirandyipnitv-showsmakabawibihiraumulanhistoriaisinalaysaymatandangsumalakaygagamithiramano-anopwestopatawarinsementongsukatinkasalukuyangoodeveningmindanaoditounapagsasalitanagkakatipun-tiponnagpapaniwalabarung-barongobserverermagasawangpinakamatapatpangungutyapaki-translatetinulak-tulakmanamis-namisnakapapasonggayunmankahirapanmanlalakbaysupilinpaki-ulitnalalabingpakikipagbabagkapasyahanhandaannakakatabalumakasnagtuturopagkapasokdumagundongnawalangartistasjobspaligsahantelecomunicacionescountrynagbentanapakabilisnapansinstayumiibigmasasabinatatawainuulamnasaanhinihintay