Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "diagnostic"

1. The development of vaccines and antibiotics has greatly reduced the incidence of infectious diseases, while the use of medical imaging and diagnostic tools has improved the accuracy and speed of diagnoses

Random Sentences

1. Ang mga hardin sa mga pribadong sityo ay ipinapalagay na mayabong at nag-aalok ng kaginhawahan.

2. Hiram muna ako ng libro na iyon bago ko desisyunang bilhin ito.

3. Dadalaw ako kay Lola Sela bukas.

4. La campaña de donación está llamando la atención de la comunidad.

5. Pahiram ng iyong mga notepads at ballpen para sa aking meeting.

6. Hindi ako makapaniwala sa nakikita ko.

7. Ano ang nangyari sa Compostela Valley?

8. Hindi ako sumang-ayon sa kanilang desisyon na ituloy ang proyekto.

9. Nagpamasahe siya sa Island Spa.

10. Oscilloscopes are useful for troubleshooting electronic circuits, identifying faults, and verifying signal integrity.

11. Ano ang pinakidala mo kay Sarita sa Maynila?

12. Les maladies infectieuses telles que le VIH/SIDA, la tuberculose et la grippe peuvent être prévenues grâce à une bonne hygiène et des vaccinations.

13. Transkønnede personer er mennesker, der føler sig som det modsatte køn af det, de blev tildelt ved fødslen.

14. Ang pagbisita sa magagandang tanawin ng Pilipinas ay ikinagagalak ng mga turista.

15. Kailan niyo naman balak magpakasal?

16. Facebook Messenger is a standalone messaging app that allows users to have private conversations with friends and contacts.

17. Pinagalitan niya ang matanda at tinulak-tulak ito.

18. The dedication of healthcare professionals is evident in their tireless efforts to provide care and save lives.

19. Technical analysis involves analyzing past market trends and price movements to predict future market movements.

20. Sa aking paglalakad, natatanaw ko ang magandang tanawin ng bukid na pambihirang nagpapalaya sa aking isipan.

21. Naglaro ako ng soccer noong Oktubre.

22. Ulysses S. Grant, the eighteenth president of the United States, served from 1869 to 1877 and was a leading general in the Union army during the Civil War.

23. A couple of lovebirds were seen walking hand-in-hand in the park.

24. ¿Qué fecha es hoy?

25.

26. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

27.

28. Pininturahan nila ang bahay ng puti upang magmukhang maaliwalas.

29. Bilang paglilinaw, ang sinabi kong deadline ay sa Biyernes, hindi sa Sabado.

30. Ipinagdiriwang sa Pilipinas ang araw ng kalayaan tuwing June 12

31. Good Friday is the day when Jesus was crucified and died on the cross, an event that represents the ultimate sacrifice for the forgiveness of sins.

32. Higupin ng halaman ang tubig mula sa lupa.

33. Naisip nilang tinangka ng kanilang anak na sunugin ang kanilang bahay.

34. Naging masaya ang aking buhay dahil sa aking mga kaulayaw.

35. Bis morgen! - See you tomorrow!

36. Cada vez que cosechamos las frutas del jardín, hacemos una deliciosa mermelada.

37. Naghingi ako ng pahintulot na hiramin ang mga kasangkapan sa kusina para sa aking cooking class.

38. Mining is the process of creating new units of cryptocurrency through complex algorithms and calculations.

39. Mapapa sana-all ka na lang.

40. Lazada offers a fulfillment service called Fulfillment by Lazada (FBL), which allows sellers to store their products in Lazada's warehouses and have Lazada handle shipping and customer service.

41. At blive kvinde kræver også mod og selvstændighed.

42. Driving fast on icy roads is extremely risky.

43. Sin agua, los seres vivos no podrían sobrevivir.

44. Representatives participate in legislative processes, proposing and voting on laws and policies.

45. Buwal ang lahat ng baldeng nalalabi sa pila.

46. Durante la época renacentista, se desarrollaron las primeras formas de música instrumental, como la guitarra y el clavicémbalo

47. Nakakain ka ba ng mga pagkaing Pilipino?

48. "Love me, love my dog."

49. Anong award ang pinanalunan ni Peter?

50. There were a lot of toys scattered around the room.

Recent Searches

sinkdiagnosticheheadicionalespulubikapetwitchcelularespedrokinakabahanconectadoswalisseekdawparagraphsfelttuwangomeletteiskopierinisiconmagbungaoncecongratsdontrichnagreplybugtongtools,condulaaseanmasakitjamesfriesstrategytvskainanpotentialmaputihimselfbeginningexitideamultolcdipapainitincreasinglyconectanheiquicklyrelievedreallyalignsnaintindihanipinaalammakangitiparisukataggressionbaranggaycapacidadrecentlyprotestamagsasakapapalapitdalawindividedpagkuwanagulatnakiniginordermininimizenagsilapitpakisabipinagawagayundinpagbabagong-anyosabadotuyotrecentafterbilhanputahehastanakabulagtanganibersaryonapakagandapinakamatabangnagkakakaincoaching:pagkaimpaktomag-orderre-reviewkayang-kayangmagpaliwanagtayomagkakagustokumakalansingmerlindatulalavirksomhederkasintahanlabingtinignanlumusobpinilingandamingmedidamabagalamongnahuhumalingangheltelebisyonpageviewnamilipitmasyadongsementongmagpahabapaninigascafeteriasumasakitinaasahanbateryanagbabasacomienzanpalakalipatqualitygayunpamanitinalimessagemahabolcurrentborgerebetweengranadamagpa-checkuplilipaditinaaslabinsiyampinapasayasiksikannagtutulakmabigyantogethermasiyadocoinbasetinatawagpictureseroplanonatutuwafinishedscottishkampeonnagtataebisitayumuyukonausalhumigaipinangangakmakikipaglarokauna-unahangmediumbaguiosumuothinogperangwatchpressmerrylibroaircontennismalakipesosplaysdalawtiyakarabiaisuottataassiyamdeterioratemagawaopportunitynasisiyahanconditioningtuyomag-iikasiyamgrewcare1876pagkaangatyongtawaawtoritadongpicsbell