Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

36 sentences found for "were"

1. A couple of actors were nominated for the best performance award.

2. A couple of cars were parked outside the house.

3. A couple of dogs were barking in the distance.

4. A couple of lovebirds were seen walking hand-in-hand in the park.

5. A couple of minutes were left before the deadline to submit the report.

6. A lot of birds were chirping in the trees, signaling the start of spring.

7. Cars were honking loudly in the middle of rush hour traffic.

8. Cybersecurity measures were implemented to prevent malicious traffic from affecting the network.

9. In the early days, telephones were connected to a central switchboard, which connected calls manually

10. Lee's martial arts skills were legendary, and he was known for his incredible speed, power, and agility

11. One April Fool's, my sister convinced me that our parents were selling our family home - I was so upset until she finally revealed the truth.

12. The acquired assets were carefully selected to meet the company's strategic goals.

13. The acquired assets were key to the company's diversification strategy.

14. The authorities were determined to find the culprit responsible for the environmental damage.

15. The authorities were stumped as to who the culprit could be in the unsolved case.

16. The company had to cut costs, and therefore several employees were let go.

17. The company's losses were due to the actions of a culprit who had been stealing supplies.

18. The detectives were investigating the crime scene to identify the culprit.

19. The Lakers have had periods of dominance, including the "Showtime" era in the 1980s, when they were known for their fast-paced and entertaining style of play.

20. The patient's immune system was compromised due to their leukemia, and they were advised to take extra precautions to avoid infections.

21. The police were searching for the culprit behind the rash of robberies in the area.

22. The police were trying to determine the culprit behind the burglary.

23. The project was behind schedule, and therefore extra resources were allocated.

24. The transmitter and receiver were connected by a network of wires, which allowed the signals to be transmitted over long distances

25. There were a lot of boxes to unpack after the move.

26. There were a lot of flowers in the garden, creating a beautiful display of colors.

27. There were a lot of options on the menu, making it hard to decide what to order.

28. There were a lot of people at the concert last night.

29. There were a lot of toys scattered around the room.

30. They were originally established in 1947 as the Minneapolis Lakers before relocating to Los Angeles in 1960.

31. Trump's rhetoric and communication style were often unconventional and garnered both passionate support and strong opposition.

32. We were planning on going to the park, but it's raining cats and dogs, so we'll have to stay indoors.

33. We were stuck in traffic for so long that we missed the beginning of the concert.

34. We were trying to keep our engagement a secret, but someone let the cat out of the bag on social media.

35. We were trying to keep the details of our business plan under wraps, but one of our investors let the cat out of the bag to our competitors.

36. With the advent of television, however, companies were able to reach a much larger audience, and this led to a significant increase in advertising spending

Random Sentences

1. Oh sige na nga sabi mo eh. hehe.

2. Proper identification, such as a collar with a tag or microchip, can help ensure a lost pet is returned to its owner.

3. Ang mga ngipin na hindi naipapatingin sa dentista ay maaring magdulot ng iba't ibang sakit sa bibig.

4. Sa sobrang antok, aksidente kong binagsakan ang laptop ko sa sahig.

5. Ang mga dentista ay may mga kagamitan na ginagamit upang masiguro na malinis at malusog ang mga ngipin.

6. Ang mga magulang ay dapat na itinuring at pinahahalagahan bilang mga gabay at tagapagtanggol ng kanilang mga anak.

7. Nous allons faire une promenade dans le parc cet après-midi.

8. Mabuti pa nga Babe, bugbugin mo na yan. pagbibiro nila.

9. Cate Blanchett is an acclaimed actress known for her performances in films such as "Blue Jasmine" and "Elizabeth."

10. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

11. Work can also provide opportunities for personal and professional growth.

12. Kanina pa kami nagsisihan dito.

13. She has just left the office.

14. Upang hindi makalimot, laging may sticky notes ang malilimutin na si Bea.

15. Bigla niyang naalala si Helena, napatigil siya sa kanyang pag-iyak at napangiti na lang ang binata.

16. La película que produjo el estudio fue un gran éxito internacional.

17. All these years, I have been inspired by the resilience and strength of those around me.

18. May anak itong laging isinasama sa paglalaba.

19. Hindi dapat nakatutok tayo sa mga kababawan ng buhay, kundi sa kabutihan ng ating kapwa at ng ating bansa.

20. Es importante limpiar y desinfectar las heridas para prevenir infecciones.

21. Ang mga natatanging likhang-sining ay dapat na itinuring bilang mga obra ng kahusayan at katalinuhan ng mga artistang naglikha.

22. Hindi ko maintindihan kung bakit kailangan ko pang magtiis sa ganitong sitwasyon.

23. Pagkuwa'y bigla na lamang nitong kakayurin ng hintuturo ang balat sa kanyang batok.

24. Sa panitikan, maaari nating makilala ang mga kilalang manunulat ng bansa, tulad ng mga makata at nobelista.

25. I am not planning my vacation currently.

26. Tantangan hidup dapat muncul dalam berbagai bentuk, baik dalam bidang pribadi, profesional, atau emosional.

27. Ang mga anak-pawis ay nangangailangan ng patas na pagkakataon upang magkamit ng tagumpay at umangat sa buhay.

28. Maria, si Ginang Cruz. Guro ko siya.

29. She has a poor credit history due to late payments and defaults on loans.

30. Pakibigay na lang sa punong-guro ang liham ng mga magulang mo.

31. Natuwa ang binata sa kanya at nagwikang "Magandang umaga din sa iyo"

32. Bakit, saan ba ang iyong kaharian? malambing na tugon ng prinsesa.

33. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

34. Nagulat ako sa kanyang biglaang pagbisita, ngunit ito ay nagdulot ng kasiyahan sa aming pamilya.

35. May maruming kotse si Lolo Ben.

36. Nous avons choisi une chanson spéciale pour notre première danse.

37. Nagsagawa ang pulisya ng mga raids sa mga tahanan ng mga kilalang salarin sa lugar.

38. Lumiwanag ang mukha ni Ana nang makita ang resulta ng exam.

39. Marahil ay hindi ka na magkakaroon ng pagkakataon na gawin ang bagay na ito.

40. ¡Hola! ¿Cómo estás?

41. Ano ba pinagsasabi mo! Baliw ka ba! Umalis ka nga!

42. The airport was busy, and therefore we had to arrive early to catch our flight.

43. Ang mga dentista ay maaaring mag-rekomenda ng mga produkto na dapat gamitin upang mapanatili ang malusog na ngipin.

44. Naglalaway ako sa tuwing nakakakita ako ng masarap na kakanin.

45. He won his fourth NBA championship in 2020, leading the Lakers to victory in the NBA Bubble.

46. Si Aling Pising naman ay nagpupunta sa bayan upang ipagbili ang mga nagawang uling.

47. Nag merienda kana ba?

48.

49. Nagtatanong ako sa kanya kung ano ang mga gusto niya upang masiguro na magugustuhan niya ang aking mga regalo.

50. Ipinakita ng albularyo ang kanyang halamang gamot na ginagamit niya sa pagpapagaling.

Recent Searches

inulitsoccerwereasoanumancharismatickatabingdalandanseekmatindingcalleripagamotfeedback,bernardonammasdanpshcompostelajoshmodernkumarimotdontproblemamulicompartenforcesduribuwalprovenathanbinigyangideasofficetomartechniqueseksenamulti-billionbigfistspostersumapittrackspaactingfinishedleestrategycomeluisfloorinfluenceyumakapdyiprelieved1982badingcrazysecarseclientesdarkbitawanbehalfbeginningconnectionredputoldoonmemoryduloneedsbehavioreithermanagermasterplatformbetatechnologiesscaledeclarepersistent,tataybodegacrucialtiniradorcompletenamilipitmaihaharapnasasabihanpambansangtopic,maasimtumutubopaglisanpedema-buhaymaisusuotsagasaanpahiramtotoongpagsagotasignaturatalagakunehoobstaclestinungokaliwasumasayawsunud-sunodsankagandahumpaykirotresearch,panunuksomaibadiinvampiresbarnescryptocurrency:pilasorebiroresourcesallowedactorpapasokvariousipinagbilingeducationalrichginalilipadydelsersementoperseverance,nakapikitmaestrapneumoniajulietdyosaiikotnakukuhakategori,bataikinamataymagtatagalnanlilimahidkonsentrasyonnabalitaannagtatakbokomunikasyonhumiwalaykinatatakutankinatatalungkuanglasingfilmnagpaalamkapangyarihankagalakantuluyanpinabayaanmakikipagbabagnagpapakainmagkaibapaga-alalakinagalitantungawhiwamakatatloinirapannakapaligidmanghikayatentrancenakatuloggagawinmatapobrengmatalinounti-untikamiassulyapkalaunanpinasalamatankabutihanhayaanpagkainisdeliciosahouseholdsdiretsahangpinapaloutak-biyapakikipaglabanilalagaynanunuksokilongbalediktoryansenadornag-emailnakabibingingmagpasalamatkontrata