Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

8 sentences found for "marketing"

1. Affiliate marketing: If you have a blog or social media following, you can earn money by promoting other people's products and earning a commission on any sales you generate

2. Don't be fooled by the marketing gimmick, there's no such thing as a free lunch.

3. Emphasis is often used in advertising and marketing to draw attention to products or services.

4. L'intelligence artificielle peut aider à prédire les comportements des consommateurs et à améliorer les stratégies de marketing.

5. Some businesses have started using TikTok as a marketing tool to reach younger audiences.

6. The business started to gain momentum after a successful marketing campaign.

7. Today, television advertising is a multi-billion dollar industry, and it plays a crucial role in many companies' marketing strategies

8. Twitter is also used by businesses and brands for marketing, customer engagement, and brand promotion.

Random Sentences

1. Maria, si Ginang Cruz. Guro ko siya.

2. Kailan ka libre para sa pulong?

3. Hinugot niya ang lakas ng kanyang katawan upang maitulak ang sasakyan na nabangga.

4. Abs yan!! Tingnan mo nga oh! May mga guhit guhit!

5. Disse inkluderer terapi, rådgivning og støttegrupper.

6. Hay muchos riesgos asociados con el uso de las redes sociales, como el acoso cibernético.

7.

8. Leonardo da Vinci nació en Italia en el año 1452.

9. El powerbank es una solución conveniente para cargar teléfonos móviles, tabletas u otros dispositivos en movimiento.

10. Sa pagguhit, mahalaga ang pagpapakita ng depth at perspective sa mga larawan para maging realistic ang mga ito.

11. Mahilig akong makinig ng music kaya laging nahuhumaling sa mga bagong kanta.

12. Magdoorbell ka na.

13. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

14. Ang aming angkan ay nagpapahalaga sa pagiging matapat sa mga relasyon.

15. Ang sigaw ng matandang babae.

16. Tango lang ang sinagot ni Mica. Bumaling sa akin si Maico.

17. The success of Tesla has had a significant impact on the automotive industry, inspiring other automakers to invest in electric vehicle technology and develop their own electric models.

18. At ginawaran ng isang matamis na halik ang labi ng naguguluhang si Mariang Maganda.

19. Gracias por tu amabilidad y generosidad.

20. Los héroes son personas que enfrentan grandes desafíos y se levantan para superarlos.

21. La conciencia nos ayuda a entender el impacto de nuestras decisiones en los demás y en el mundo.

22. Minsan kailangan din nating magmangiyak-ngiyak para maipakita natin ang totoong nararamdaman natin.

23. Gusto po ba ninyong lumipat sa ibang kuwarto?

24. The invention of the telephone and the internet has revolutionized the way people communicate with each other

25. Si Dr. John ay isang doktor sa kanilang baryo.

26. The influence of a great teacher on their students is immeasurable.

27. Ang pagdating ng malalakas na pag-ulan ay binulabog ang mga lansangan at nagdulot ng matinding pagbaha.

28. Cheap sunglasses like these are a dime a dozen.

29. The movie was rated R, and therefore she wasn't allowed to watch it.

30. Ano ang gagawin ni Trina sa Disyembre?

31. Ang bilis natapos ng palabas sa sinehan.

32. Ibinigay ko ang aking panalangin at dasal para sa mga nangangailangan ng tulong.

33. La fotografía es una forma de arte que utiliza la cámara para capturar imágenes y expresar emociones.

34. Her charitable spirit was evident in the way she helped her neighbors during tough times.

35.

36. The king's legacy may be celebrated through statues, monuments, or other memorials.

37. Mi amigo me enseñó a tocar la guitarra y ahora podemos tocar juntos.

38. Marunong nang maglinis at magtago ang mga taong marurumi.

39. Makisuyo po!

40. The exchange of rings is a common tradition in many weddings.

41. Si Aguinaldo ay nahuli ng mga Amerikano noong 1901 sa Palanan, Isabela.

42. Sa panahon ng kahirapan, mahalaga ang mga kaulayaw na handang magbigay ng suporta.

43. The team's games are highly anticipated events, with celebrities often seen courtside, adding to the glamour and excitement of Lakers basketball.

44. Puwede bang makausap si Clara?

45. Ito'y hugis-ulo ng tao at napapalibutan ng mata.

46. Ailments can impact one's daily life, including their ability to work, socialize, and engage in activities.

47. I'm not superstitious, but I always say "break a leg" to my friends before a big test or presentation.

48. Noong una ho akong magbakasyon dito.

49. Commuters are advised to check the traffic update before leaving their homes.

50. May luha nang nakapamintana sa kanyang mga mata at ang uhog at laway ay sabay na umaagos sa kanyang liig.

Similar Words

marketing:

Recent Searches

marketingnakilalamakawalakumirotmaghahabinagagamitinakalamamalaschoosepinagsasabictileskelanganlumipatporamoymarangaldecreasedrespektivesubject,gubatpagbibiromantikamagsabiberetiipinambilipauwidissenangingilidescuelashelenateachingslunasbagamatsandwichnakihalubilospanagdalasoccerbiyernesadmirednapasukorecibirawitinitinulosnatutuwasisentaebidensyanakakapuntaduwendemagbasakapeteryabundokreviewnenafiverrhoynapapikito-orderrepublicansandalingelenalakadincidencebeganeducativasjoemapaibabawbilibhumblechildrenbinanggaambagcharismaticsumamaibalikritoparagraphslegendspropensolutoasimpinatidloansniyandiagnoseshancharmingstevesumugodlabingelectionsuncheckedchadpaligsahanmeandaddyinformationstagemainitbosesnutrientescountriessurgerymapakalipaafeltinsteadthirdsynckasingsetsulointeractfallnaghihinagpispinagsikapansinabingliv,gripopagpiliipinasyangninongmag-aralpagkaangatnanangismagkamalibalahibopakibigyanmalihisrumaragasangpagguhitcarolayanmangiyak-ngiyakcitizeniba-ibanglandemonetizingipagtimplatanggalinblessincreaseintopinagmamalakinakakapagpatibaynaka-smirksalamangkerotaga-nayontinulak-tulaknakaluhodnalulungkotpagkagustopresence,pagtangisrebolusyonnagpepekepapanhiknamumutlapagmamanehonag-poutmagdoorbellnakapasapakakatandaankwartoatensyongiloilonagkalapitteknologijuegostangekspaghalikhayaankagipitanmaisusuotuugod-ugodngumiwiskillsuniversitynakaakyathahahanakituloghawaiiintindihinhulihannagbentapaparusahanpamumunonothingbighanipwedengmatagumpaypatakbongnanamanlumindolbinuksanempresaspalasyowidetawagparke