Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

7 sentences found for "musicians"

1. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

2. He continues to be an inspiration to generations of musicians and fans, and his legacy will live on forever

3. He was one of the first musicians to popularize rock and roll, and his music and style helped to break down racial barriers and bring different cultures together

4. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

5. Nationalism can be a source of inspiration for artists, writers, and musicians.

6. The festival showcases a variety of performers, from musicians to dancers.

7. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

Random Sentences

1. La foto en Instagram está llamando la atención de muchos seguidores.

2. A portion of the company's profits is allocated for charitable activities every year.

3. Magkano ho ang arkila ng bisikleta?

4. Dumating ang bus mula sa probinsya sa hatinggabi.

5. The United States is known for its entertainment industry, including Hollywood movies and Broadway shows.

6. All these years, I have been building a life that I am proud of.

7. Les personnes motivées ont tendance à être plus productives et à atteindre leurs objectifs plus rapidement.

8. Our transport systems-diesel-run railways, steamships, motor vehicles, and aeroplanes-all constantly need natural fuel to keep on moving

9. The policeman directed the flow of traffic during the parade.

10. Ang mga pag-uusig at pang-aapi ay mga halimbawa ng malubhang paglapastangan sa karapatan ng tao.

11. Di nagtagal, muli niyang naramdaman na tila nangangalirang na naman ang kanyang balat.

12. Me duele todo el cuerpo. (My whole body hurts.)

13. May grupo ng aktibista sa EDSA.

14. The actor received a hefty fee for their role in the blockbuster movie.

15. Siya ay hinugot ng mga pulis mula sa kanyang bahay.

16. Ang abilidad sa pangangalaga ng kalusugan ay mahalaga upang mapanatili ang malusog na pamumuhay.

17. Nice meeting you po. automatic na sabi ko.

18. Ganun ba? Sige samahan na lang muna kitang maghintay dito.

19. May kahilingan ka ba?

20. Masarap ang litson kaya lang nakakataba.

21. Congress is divided into two chambers: the Senate and the House of Representatives

22. His unique blend of musical styles

23. Hindi dapat natin balewalain ang mga banta ng kalamidad, datapapwat ay hindi naman ito sigurado na magaganap.

24. Nag mungkahi naman ang Mayor na dapat unahin munang bigyan ng ayuda ang mga senior citizens.

25. Sino yung naghatid sayo? biglang tanong niya.

26. Sin agua, los seres vivos no podrían sobrevivir.

27. Les personnes qui manquent de motivation peuvent être découragées et avoir des difficultés à accomplir leurs tâches.

28. Ang pagdating ng mahigpit na bagyo ay nagdulot ng malalakas na alon at binulabog ang mga bayan sa tabing-dagat.

29. Limitations can be overcome through perseverance, determination, and resourcefulness.

30. Limitations can be self-imposed or imposed by others.

31. Sa lahat ng mga tao sa paligid ko, ikaw lang ang nais kong sabihin na may gusto ako sa iyo.

32. Certains pays et juridictions ont des lois qui régulent le jeu pour protéger les joueurs et prévenir la criminalité.

33. Ang aming pamilya ay mahilig magsagwan sa karagatan tuwing Sabado.

34. It's not wise to burn bridges in the professional world - you never know when you might need someone's help in the future.

35. Sa tuwa ng Elepante ay kumembut-kembot ito sa pag-indak.

36. Nangyari ang aksidente sa daan kahapon kaya maraming sasakyan ang naabala.

37. Laking gulat niya nang mawala ang batang umiiyak.

38. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

39. Ahh... haha. Umiling na lang ako bilang sagot.

40. Nous avons fait un discours lors de notre réception de mariage.

41. Ang paglapastangan sa mga pampublikong lingkod ay dapat maparusahan nang naaayon sa batas.

42. Cancer can have physical symptoms, such as pain, fatigue, and weight loss, as well as emotional symptoms, such as anxiety and depression.

43. Kaagad namang nakuha ng mangangahoy ang kanyang palakol kaya't nasugatan nito ang tigre sa leeg nito.

44. Makakarinig ka ng halinghing sa gym, lalo na kapag may nagta-training ng cardio.

45. May konsyerto sa plasa mamayang gabi.

46. L'intelligence artificielle peut aider à optimiser les processus de production industrielle.

47. Magtanim ay di biro, maghapong nakayuko.

48. Ang pag-asa ay nagbibigay ng pag-asa sa mga taong nakakaranas ng mga krisis at mga suliranin sa buhay.

49. Les étudiants peuvent obtenir des diplômes dans une variété de domaines d'études.

50. Mula sa pagiging simpleng atleta, si Hidilyn Diaz ay naging simbolo ng determinasyon at tagumpay.

Recent Searches

o-ordermusiciansdialledinastaipag-alalacompostelafueroommadamimakasarilingfonostoreteburmaexcuselintawidespreadtanimotroroboticusedkomunidadbinigaysellandaming1980afternoonboksinggoalcolourkaaya-ayangnakangangangpinilistarwalagreenteachmapaputahemabutingngpuntapupuntaaltipinabalikkaringimaginginalokbeginningbitawanfeelingshockfatalpinalakingplatformsemphasiswaysklaselilimtaonanotherpracticeslutuinwindowaffectsettingformscomputerecornerbroadcastsgawaingkamandagnakakapagpatibaycombinedumuwimagtagokainkinakainkubobreaknataposawitayokonagdaramdamluismanuscriptlikaspusoanihininalisboyespanyolatensyonmatatagtalinotinionaghandarollipasokbalinganpakpakdalawamagbibitak-bitaksagabalmayabongdivisoriamasayang-masayainsteadexperiencese-booksmaliitkapagsyncbulaksalitangsongdescargardeathnapakanilangmiyerkolesorkidyasnaninirahanhumarapgayunpamannakakapasokbayanleukemiayakapinpagenatatangingdintagtuyotperfectcapitalspendingentrancemagsunogpangalandioxidemaalikabokmangyaripaalamjulietgarbansosexpertspeechnakatirapadabogtarangkahan,evennamungadaramdaminkinalilibingani-rechargeunattendedcultivarpagkabuhaynagpuyospagkataposmahahalikdoble-karakasiyahanmarketplacesnapakahusaypinahalatananlilimahidnakakapamasyalpinakamahalagangagwadormalakisinumankayamagamotpartstungkodjingjingkatutubolumabaspakikipaglabanmagdamaganmagandangadgangitinatapatsalbahengisinusuotbahagyanagwalislibertywriting,nakapagproposenakitulognatinagcardiganipinauutanglansangantumamanapakaramingnagniningningnapadpadhanapinpaliparin