Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "nakinig"

1. Nakinig ang mga estudyante sa guro.

Random Sentences

1. Sehari di negeri sendiri lebih baik daripada seribu hari di negeri orang.

2. Musk has expressed a desire to colonize Mars and has made significant investments in space exploration.

3. Joshua, kumusta ang pakiramdam mo?

4. Dapat pinakamasaya ang Sabadong ito sa lahat ng Sabado.

5. Electric cars can provide a smoother and more responsive driving experience due to their instant torque.

6. James Buchanan, the fifteenth president of the United States, served from 1857 to 1861 and was in office during the secession of several southern states.

7. Naghihinagpis ang ina sa pagkamatay ng kanyang anak na nauwi sa isang aksidente.

8. Healthcare providers and hospitals are continually working to improve the hospitalization experience for patients, including enhancing communication, reducing wait times, and increasing patient comfort and satisfaction.

9. La poesía de Neruda tiene una elegancia sublime que conmueve al lector.

10. Limitations can be overcome through perseverance, determination, and resourcefulness.

11. Investors with a higher risk tolerance may be more comfortable investing in higher-risk investments with the potential for higher returns.

12. Lumapit siya sa akin tapos nag smile. Nag bow ako sa kanya.

13. Foreclosed properties can be a good investment opportunity for those who have the time and resources to manage a rental property.

14. Menos kinse na para alas-dos.

15. Masarap magluto ng midnight snack sa hatinggabi kapag nagugutom ka.

16. Gaano katagal ho kung sasakay ako ng dyipni?

17. A father's love and affection can have a significant impact on a child's emotional development and well-being.

18. These films helped to further cement Presley's status as a cultural icon and helped to solidify his place in the history of American entertainment

19. Ang daming limatik sa bundok na kanilang inakyat.

20. Marahil ay hindi pa ito ang tamang panahon upang magpakasal.

21. She always submits her assignments early because she knows the early bird gets the worm.

22. Patients may experience pain, discomfort, and anxiety during their hospital stay.

23. "Hindi lahat ng kumikinang ay ginto," ani ng matandang pantas.

24.

25. Ano ang binibili ni Consuelo?

26. Hindi ko gusto ang takbo ng utak mo. Spill it.

27. Platforms like Upwork and Fiverr make it easy to find clients and get paid for your work

28. L'intelligence artificielle peut être utilisée pour prédire les résultats des élections et des événements futurs.

29. Natakot umano ang mga estudyante nang marinig ang kwento tungkol sa multo sa eskwelahan.

30. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

31. I'm not superstitious, but I always say "break a leg" to my friends before a big test or presentation.

32. Gumagawa ng tinapay si Tito Mark sa kusina.

33. Medical technology has also advanced in the areas of surgery and therapeutics, such as in robotic surgery and gene therapy

34. She spilled the beans about the surprise party and ruined the whole thing.

35. Buenas tardes amigo

36. Mahilig siyang kumuha ng litrato sa oras ng takipsilim.

37. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

38. Sambit ng prinsipe habang hinahaplos ang pisngi ng iniirog.

39. The Flash can move at superhuman speed, making him the fastest man alive.

40. Isang beses naman ay ang sandok ang hinahanap.

41. Les travailleurs peuvent changer de carrière à tout moment de leur vie.

42. The teacher does not tolerate cheating.

43. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

44. Mange steder i Danmark afholdes der påskeoptog og andre offentlige begivenheder i løbet af Holy Week.

45. Asul ang kulay ng mata ng anak ko.

46. Dahil sa lockdown ay bumagsak ang ekonomiya ng Pilipinas.

47. She helps her mother in the kitchen.

48. Sopas ang ipinabalik ko sa waiter.

49. Alam ko maraming uncertainties sa buhay, pero sana pwede ba kitang mahalin?

50. Kapansin-pansin ang dami ng mga insekto na naglipana sa gabi.

Recent Searches

nanayina-absorvenakiniggreatlymakulitnahulognapakoquarantineaksidentecapitaltrafficconsumebankdecreaseresearchsapagkatnammensajesydelserkitmagdaanventagraduallylimitsteerresponsiblebinabakarnabalpopulationtopic,leadbetweenvaninaapitechnologiesmenusummithalosstreamingmahagwaymagpapaligoyligoytiniradoragilitymaglabadahilngunitperotradisyontinderakatutubopicturespagsisisilockedfilipinoindvirkningtypenasasabihanpahahanapnakakasulatpare-parehomayapagsagottilamamasyalasignaturanagsamaintramurosnakitakabarkadameronkasinggandanaiwangunidosartificialipinamilithoughtabanakakadalawnapakatagalkusinerobecomingkakuwentuhanpakealammaruruminahulifrancisconabubuhaypangitescuelascubarestawankolehiyosilbingnagkalapitsayawanmagpaliwanagcommerceisipkaarawaninyolookedwalisawardmakapagpigilnapakayumabongminamahalmaatimmakawalamaramikasalananimaginationonlykasinglunasbakasalarinnagtatrabahowalkie-talkiekayang-kayangbaku-bakongeventosnakatitigkainnapapahintonanghuhuliinuulcerencuestasmaliwanagguitarrainternacionalbinibiyayaannamumulotsasayawinnakaluhodressourcerneobra-maestranakapagsabinamulaklakpagtataasmagagawautak-biyamaliksipagmamanehomakapalagnakatalungkopabalangpinauwipahaboltaoskapintasangbutikinagbibirokanyapinagmasdanpagdiriwangnakarinigbusiness:susunodkinakaintsonggopundidohahahapagbabantabilibidbuwayacashkutsilyobanaltawanannatutuwasuriinporhelenainalagaanhundredpangalanparurusahansurroundingsilagaytagaroonlazadaexpresanmaistutoringadangitinagomayroonbegansemillasgrammarmalihispancitmayomallpedrochavitgearnatanggapguhit