Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

4 sentences found for "afternoon"

1. Good afternoon po. bati ko sa Mommy ni Maico.

2. She is not playing the guitar this afternoon.

3. The meeting was cancelled, and therefore he had the afternoon off.

4. They are not attending the meeting this afternoon.

Random Sentences

1. La deforestación es la pérdida de árboles y plantas en los bosques debido a la tala indiscriminada.

2. However, investing also carries risk, as the value of investments can fluctuate and can result in losses.

3. Habang nag-oorasyon nagising si Mang Kandoy dahil sa mga bulong ng salamangkera.

4. También es conocido por la creación de la Capilla Sixtina en el Vaticano.

5. Ito ang tanging paraan para mayakap ka

6. Inakalang nagtatampo ang kapatid niya, pero hindi naman pala.

7. Patients may need to undergo tests, procedures, or surgeries during hospitalization to diagnose and treat their condition.

8. Ano ang ilalagay ko sa kusina?

9. She found her passion for makeup through TikTok, watching tutorials and learning new techniques.

10. Emphasis can be achieved through various means, such as tone of voice, body language, and word choice.

11. Ang pagdarasal o meditasyon ay nakagagamot sa aking kalooban at nagbibigay ng kapayapaan.

12. I am absolutely thrilled about my upcoming vacation.

13. Tatlong linggo kami dito sa Pilipinas.

14. The patient was diagnosed with leukemia after undergoing blood tests and bone marrow biopsy.

15. Sino yung naghatid sayo? biglang tanong niya.

16. Einstein's work challenged traditional notions of reality and paved the way for new and innovative approaches to understanding the universe.

17. Marami sa atin ang may mga pangarap sa buhay na nais nating tuparin.

18. Cancer is caused by a combination of genetic and environmental factors, such as tobacco use, UV radiation, and exposure to carcinogens.

19. Pagdating namin dun eh walang tao.

20. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

21. Hindi iniinda ng magkakapatid na Lala, Dada at Sasa ang nakapapasong init ng araw sapagkat ito ay nagpapakinis pa nga ng kanilang kutis.

22. Akin na cellphone mo. paguutos nya.

23. Mahalagang regular na magpatingin sa dentista upang maiwasan ang mga dental problem.

24. Palmesøndag er den første dag i Holy Week og markerer Jesu triumfmodtagelse i Jerusalem.

25. Walang nakakaalam kung saan sila napupunta.

26. Bakit, saan ba ang iyong kaharian? malambing na tugon ng prinsesa.

27. Les jeux peuvent avoir des règles et des limitations pour protéger les joueurs et prévenir la fraude.

28. Saka dalawang hotdog na rin Miss. si Maico.

29. Påskeæg er en traditionel gave i påsken og er ofte fyldt med slik eller små gaver.

30. Binili ko ang damit para kay Rosa.

31. Ang pagkakaroon ng sapat na kaalaman at impormasyon ay nagpapawi ng mga agam-agam at kawalang-kasiguruhan.

32. Work can also provide opportunities for personal and professional growth.

33. Maraming daga ang nahuli ng pusa ni Leah.

34. Puwedeng dalhin ng kaibigan ko ang radyo.

35. Reinforcement learning is a type of AI algorithm that learns through trial and error and receives feedback based on its actions.

36. Sa huling pagkakataon ang mga isda ay nagsalita.

37. Der er en række organisationer og programmer, der tilbyder hjælp til mennesker, der kæmper med gamblingafhængighed.

38. Para sa anak ni Consuelo ang T-shirt.

39. Bilang paglilinaw, ang ating proyekto ay hindi pa tapos kaya hindi pa ito maaaring ipasa.

40. Kevin Garnett was a versatile power forward who brought intensity and defensive prowess to the court.

41. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

42. Ang mga estudyante ay bumalik na sa kanilang mga dormitoryo sa hatinggabi.

43. Ang pag-asa ay nagbibigay ng mga oportunidad sa mga tao upang magpakasaya at mag-enjoy sa buhay.

44. Al elegir un powerbank, es importante considerar la capacidad de la batería, el tamaño y la compatibilidad con los dispositivos que se cargarán.

45. En México, el Día de los Enamorados se celebra con una fiesta tradicional llamada el Día del Cariño.

46. Las heridas que no sanan o empeoran con el tiempo pueden ser signo de una enfermedad subyacente y deben ser evaluadas por un médico.

47. Ilan ang computer sa bahay mo?

48. Pakibigyan mo ng tip ang waiter.

49. Naririnig ko ang malakas na tunog ng ulan habang ako ay tulala sa bintana.

50. Cancer can affect any part of the body, including the lungs, breasts, colon, skin, and blood.

Recent Searches

afternoondalawinvelfungerendenuevosocietyninyongsahiglakadgrocerywakasmabibinginagtatampotelevisionhanggangnapabayaanpagpapasanproducererdatapuwagasolinaeffektivmensajesganitonegosyopromoteimbesdiseaseslaranganprosesomedievalasiakubopatonglumalakinatutuwamataraykumatokmaingatkombinationnetflixinakyattiniklagunamaghandacarriesiigibfamehinigitayokomarteskelananywheregabrielplasahappenedmakabilimanuscriptgrewlayas1940senateorderinnagpuyosnagbasabarokalakingattractivecontrolanapanoodpaaralannapansinbiggestcoatideyaoutlineslatefertilizerbauldilimindividualkakilalaestablishthesepwedengano-anoincreasinglysincetextofriesposterabstainingconcernsperanggoingcomunesfullsamababestateworkdaystandclearnaiinggitlcdmaglalabing-animsolidifycomplexrepresentativeworkshopbalingulocallinghighestclassmateworkingknowbilihininantayika-50alingnutspagkalungkottatanghaliinprodujomagpapapagodnag-emailitongbroadlumakiplacemaasahanlayuanumupoihandaautomatiskbihiraentrebilhanbeganlabingdyosacallermakinginvestmagnifysinabikailanschoolsharmfuliniwanklimaelvisnanayclientelinawnag-umpisananghihinamadkagustuhangkatotohananpresence,nanghahapdipagkakalutomarurumibumigaydispositivospecializedproductsmatangumpaypang-isahanginstrumentalpinakamahabaconventionalbarung-barongkomunikasyonhinagud-hagodmagpa-picturedonetuvobangduladatasigataletoysmamimalltaasrosalutobaleideatilaexperience,paki-chargenanaignag-isipnag-iisanilinisarteellawindow