Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

4 sentences found for "afternoon"

1. Good afternoon po. bati ko sa Mommy ni Maico.

2. She is not playing the guitar this afternoon.

3. The meeting was cancelled, and therefore he had the afternoon off.

4. They are not attending the meeting this afternoon.

Random Sentences

1. Les assistants personnels virtuels, tels que Siri et Alexa, utilisent l'intelligence artificielle pour fournir des réponses aux questions des utilisateurs.

2. Environmental protection can also have economic benefits, such as creating jobs in sustainable industries.

3. Today, television advertising is a multi-billion dollar industry, and it plays a crucial role in many companies' marketing strategies

4. Pull yourself together and focus on the task at hand.

5. La conciencia nos ayuda a ser responsables de nuestras acciones y decisiones.

6. Pinagtatalunan nila kung sino ang mas may karapatang manirahan sa malago at mayamang kagubatan.

7. Tuluyan na siyang pumasok ng kwarto at isinara yung pinto.

8. Las drogas pueden alterar el estado de ánimo y la percepción de la realidad.

9. The event was sold out, and therefore we couldn't get tickets.

10. I can't keep it a secret any longer, I'm going to spill the beans.

11. He is not typing on his computer currently.

12. Come on, spill the beans! What did you find out?

13. Saka na yun, pag fiance ko na sya saka ko sya liligawan!

14. Malinis na bansa ang bansang Hapon.

15. Kucing adalah salah satu hewan peliharaan yang populer di Indonesia.

16. Nagdulot ng kakulangan sa tubig ang matagal na tagtuyot sa kanilang lugar.

17. Malapit na ang pyesta sa amin.

18. Kumain na ako pero gutom pa rin ako.

19. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

20. It's raining cats and dogs

21. Napakagandang dalaga, wika niya sa sarili at tuloy-tuloy na nilapitan niya ito.

22. La música puede ser utilizada para fines políticos o sociales.

23. If you spill the beans, I promise I won't be mad.

24. Les chimistes travaillent sur la composition et la structure de la matière.

25. Habang naglalaba, napadungaw siya sa labas at napansin ang magandang paglubog ng araw.

26. Linggo ng umaga at ang palengke ay siksikan.

27. Ang pagsusulat ng mga saloobin at damdamin sa pamamagitan ng journaling ay isang nakagagamot na paraan upang maibsan ang aking mga problema.

28. Ang utang ay nangangahulugan ng pagkakaroon ng obligasyon na magbayad ng isang halaga sa isang tiyak na panahon.

29. The introduction of the dial telephone in the 1920s further improved the telephone system, as it allowed for faster and more efficient call connections

30. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

31. La labradora de mi sobrina es muy amigable y siempre quiere jugar con otros perros.

32. Bagaimana bisa kamu tiba-tiba hilang begitu saja? (How could you suddenly disappear like that?)

33.

34. Hindi malinis ang mga tsinelas ni Lori.

35. Sa isang iglap siya naman ang napailalim.

36. Maliit lang ang kusina ni Lola Oliva.

37. Ayoko magtrabaho sa bahay sapagkat naiinis ako sa buhok na ito.

38. Les mathématiques sont une discipline essentielle pour la science.

39. Siyang pagdating ni Roque na agad ding tumalon sa ilog upang iligtas ang mga anak.

40. The rules of basketball have evolved over time, with new regulations being introduced to improve player safety and enhance the game.

41. Madalas itong nag ku-kwenta ng kanyang mga kinikita.

42. Nakaupo sa balkonahe, pinagmamasdan niya ang mga tao na dumaraan sa kalsada.

43. Money has value because people trust that it can be used to purchase goods and services.

44. Biglang nagulat ang bata nang lumitaw sa harp niya ang isang duwende.

45. Dedication to personal growth involves continuous learning and self-improvement.

46. Rutherford B. Hayes, the nineteenth president of the United States, served from 1877 to 1881 and oversaw the end of Reconstruction.

47. Hockey games are typically divided into three periods of 20 minutes each, with a short break between each period.

48. Football players must have good ball control, as well as strong kicking and passing skills.

49. Receiving good news can create a sense of euphoria that can last for hours.

50. May pitong taon na si Kano.

Recent Searches

afternoonsilid-aralanpropesornakaakyatnanonoodkaliwaeksempelautomatiskkalabanwakasadvancementtanyagawitanxviiindustriyagumigisingkusinerolaamangkanilalinaprotegidolalimpakilagaymatutongmanaloiyakmagnifybandalalakebopolssantossalatindiaperenglandlastingfatherkatagalanpublishing,kasalananmarangyangpangilkirotwifialaskasochoikinsecombinedmasipaginanghinaboldetectedmaluwangipatuloyburmamrsresortnapatingalamaskipangitlumusobbangweresakinmaskbatomedievalasulmariopakilutopersonasstorenilinisbushardalingngpuntasolarpumuntaparinreadpuntadevelopedestablishedmemorialincreasinglytwinkleklimabungafallnariningprogramaeducationalipinaliteksenaspaagilitypaglalaitartistasunibersidadpagkabuhaycultivatatlumpungdyipniuugod-ugodliv,intramurosapelyidodispositivopinamiliincluirmaintindihanumangatmagsungitnasilawpasaheiyamotloladakilanghinatidmasayaincrediblemagsimulamagdilimbihiravivatenersisterlipadnararapatpsssdaladalauntimelyenergybansangcubiclesabihingtapenagdaramdamsupremenagbagomayroonpopularizebook:sumasambaipipilitpakelamkara-karakanandoonbagofuelipasokbadsubjectskillbetweenknowledgeipagtimplawhykubyertosmaubosnapakatalinonapakoinantaygisingtotoongsarisaringprodujomadulashinihintaynaiilangnagbantaygraduallybatimarasigannagagandahancurrenttagtuyotnutsgarbansoskabibisinabimakisuyopirasopangyayarimagsasalitakasawiang-paladhumabolmakikipaglarokokaknakalagaynaglakaddaysmagkasamahospitalpagsahodpakinabangannakapikitmanonoodsumalakay