Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

No sentences found for "pequeño"

Random Sentences

1. Nabagalan ako sa takbo ng programa.

2. Mahusay siya sa komunikasyon at liderato, samakatuwid, siya ang nahirang na bagong presidente ng organisasyon.

3. Palibhasa ay mahilig mag-aral at magpahusay sa kanyang mga kakayahan.

4. Some viruses can cause cancer, such as human papillomavirus (HPV) and hepatitis B and C.

5. Heto ako, nakakarinig ng awit at tawanan pero hindi naman nakikita ang katuwaan.

6. Limitations can be a result of societal or systemic inequalities and discrimination.

7. The Senate is made up of two representatives from each state, while the House of Representatives is based on population

8. Hockey players wear special equipment such as helmets, pads, and gloves to protect themselves from injury.

9. Les jeux de hasard en ligne sont devenus plus populaires ces dernières années et permettent de jouer depuis le confort de son propre domicile.

10. Sino-sino ang mga pumunta sa party mo?

11. The culprit behind the vandalism was eventually caught and held accountable for their actions.

12. May I know your name so we can start off on the right foot?

13. Sa pagguhit, mahalaga ang pagpili ng tamang anggulo at perspektiba.

14. He starred in a number of films in the 1950s and 1960s, including Love Me Tender, Jailhouse Rock and Viva Las Vegas

15. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

16. Some fruits, such as strawberries and pineapples, are naturally sweet.

17. I absolutely love spending time with my family.

18. Nanatili siya sa pagkakatayo nang ilang saglit, wari'y tinakasan ng lakas, nag-iisip ng mga nakaraang pangyayari.

19. Sumakay ka sa harap ng Faculty Center.

20. You can't judge a book by its cover.

21. Nakapunta ako sa Bohol at Cebu.

22. Skolegang er en vigtig del af børns opvækst og udvikling.

23. He makes his own coffee in the morning.

24. Los sueños nos inspiran a ser mejores personas y a hacer un impacto positivo en el mundo. (Dreams inspire us to be better people and make a positive impact on the world.)

25. Maari mo ba akong iguhit?

26. Sa ganang iyo, mahalaga pa ba ang kultura at tradisyon sa modernong panahon?

27. Ang bayan na matatagpuan sa lugar ng mga bundok, ay hindi matatag sa pagkakataong darating ang unos.

28. Con paciencia y perseverancia todo se logra.

29. Hindi mo na kailangan ang magtago't mahiya.

30. Ang abuso sa hayop ay isang krimen na dapat mapanagot ang mga nagkasala.

31. Sa anong tela gawa ang T-shirt?

32. The victim was relieved to finally have closure after the culprit behind the crime was caught and prosecuted.

33. Sueño con tener la libertad financiera para hacer lo que quiero en la vida. (I dream of having financial freedom to do what I want in life.)

34. Sa bawat kumpetisyon, ipinapakita ni Carlos Yulo ang kahusayan at disiplina ng isang atletang Pilipino.

35. Hindi dapat natin kalimutan ang kabutihang loob sa mga taong nangangailangan, samakatuwid.

36. Si Bereti ay mula sa angkan na may maalwang buhay.

37. No deberías estar llamando la atención de esa manera.

38. Users can create profiles, connect with friends, and share content such as photos, videos, and status updates on Facebook.

39. Overcoming challenges requires dedication, resilience, and a never-give-up attitude.

40. Known for its sunny weather, Los Angeles enjoys a Mediterranean climate throughout the year.

41. Dedication is the driving force behind artists who spend countless hours honing their craft.

42. Elektronik kan hjælpe med at forbedre miljøbeskyttelse og bæredygtighed.

43. Kamu ingin minum apa, sayang? (What would you like to drink, dear?)

44. Nais kong mapasigla ang aking katawan kaya kailangan ko ng mahabang halinghing.

45. Ngunit lumakas ang agos ng ilog, at napailalim sa tubig ang mag-aama.

46. The students are studying for their exams.

47. La pobreza es un problema que afecta a millones de personas en todo el mundo.

48. Don't waste your money on that souvenir, they're a dime a dozen in the market.

49. Los bebés pueden nacer en cualquier momento del día o de la noche, y algunas veces pueden llegar antes o después de la fecha prevista.

50. Madalas syang sumali sa poster making contest.

Recent Searches

botelorisumakitfreelancertools,humanoadditionbilersellthroughoutclassroomconventionalkararatingputaheenchantedaudio-visuallykumarimotplayedmauntogtreatsbosesdaddybulsaresultfaulttopic,multi-billionstudenttrackperamichaelchecksbringdoontipidpossiblemovingstuffedfatalcarbonerhvervslivettatlumpungibonnaiyakpatawarinnaghihikabtsinarememberedcubicleexpertisekaugnayannilulonmaisapollokumidlatbaranggaytiniradorluznasasabihankunwanagdadasalmalakasartistakumikilosbuhoknoblerevisethesenilaospagsagotnapakagandangtabinagpakitamagpa-ospitalpinagtagponagtitindakategori,kinakitaansponsorships,pagsumamopagpapautangpinagalitannanghihinananlilimahidkinikitanagbakasyonmaglalakadmaawaingnapakamotnakayukoinasikasopinagkiskisnapaiyaknakuhangnagpabayadmagbabagsikkinabubuhaymakipag-barkadah-hoybusinessestungawmagkaibangnakaraannawawalaipantalopmakikikainkare-karehumiwalaymahusaymagtigilnaghihirapyumaoumakbayabundantepambatanglinggongnagkasakitmakukulayfitnessnahigitaneksempelpalamutinakapagproposenatatawafysik,miyerkulespinangalanangjingjingkanginatsonggolikodbihirangtinanggalsugatangsinoumangatmilyongmalalakiganidmaagapanmaisipmatayogmalilimutansakimdealumiwasmatikmanduwendehabitmakapasanaiinggittumatakboourwaysnag-oorasyonpracticadoplatformshalagatruelibreputimatuklasanenforcingmapadalihappiercesstrengthcheflearnconsidersmallroughbestidamaliliitdebatesipasokbumibitiwmedyohawakinvestpagbibiromalumbaynapapikithallawitintinaposnag-iisipdilanahihiyangibaliktangingewaninformedbutiboksinginastapananakotitinaasligaligdinaluhan