Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

No sentences found for "planificación"

Random Sentences

1. Itinago ni Luz ang libro sa aparador.

2. Kumain ako ng macadamia nuts.

3. Dapat kong bilhan ng regalo si Maria.

4. Det er en vigtig del af vores moderne liv, og det har haft en stor indvirkning på måden, vi lever, arbejder og kommunikerer på

5. Today, mobile phones have become an essential part of everyday life, and they have greatly expanded the capabilities of the telephone

6. Are you crazy?! Bakit mo ginawa yun?!

7. Ang paggamit ng mga apps at gadgets bago matulog ay maaaring makaapekto sa kalidad ng tulog ng isang tao.

8. The culprit behind the product recall was found to be a manufacturing defect.

9. From: Beast Nasaan ka? Bakit di mo ako hinintay?

10. Ang pag-asa ay maaaring magdulot ng positibong pagbabago sa buhay ng mga tao.

11. He forgot his wallet at home and therefore couldn't buy lunch.

12. Medarbejdere kan arbejde på fuld tid eller deltidsbasis.

13. Puti ang kulay ng pinto ng pamilyang Gasmen.

14. Musk has been named one of the most influential people in the world by TIME magazine.

15.

16. Fødslen kan føre til hormonelle og følelsesmæssige ændringer, så det er vigtigt at tage sig af sin mentale sundhed.

17. Television has also had an impact on education

18. Einstein's legacy continues to inspire scientists and thinkers around the world.

19. El amanecer en la montaña es un momento sublime que nos conecta con la naturaleza.

20. Fødslen markerer en begyndelse på et nyt kapitel i livet som forældre og en påmindelse om, at livet er en konstant cyklus af transformation og fornyelse.

21. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

22. The feeling of falling in love can be euphoric and overwhelming.

23. Baby fever can be accompanied by increased attention to one's physical health and well-being, as individuals may want to ensure the best conditions for conception and pregnancy.

24. Las redes sociales pueden ser una herramienta para hacer networking y hacer crecer tu carrera.

25. La creatividad es fundamental para el desarrollo de ideas innovadoras.

26. Tanggalin mo na nga yang clip mo!

27. Nang siya'y mapaibabaw, sinunud-ssunod niya: dagok, dagok, dagok.

28. Salah satu bentuk doa yang populer di Indonesia adalah sholat, yang merupakan salah satu rukun Islam.

29. Les enseignants ont un impact majeur sur la vie des élèves et leur réussite scolaire.

30. Ang aking kabiyak ay ang aking kaligayahan at kabuuang kaganapan sa aking buhay.

31. Ang paglutas ng mga palaisipan ay hindi lamang tungkol sa pagpapakita ng katangian ng isang indibidwal, kundi tungkol din sa pagpapakita ng kahalagahan ng malawak na kaalaman.

32. Basketball can be a fun and engaging sport for players of all ages and skill levels, providing an excellent opportunity to develop physical fitness and social skills.

33. Miguel Ángel murió en Roma en 1564 a la edad de 88 años.

34. Bumili si Pedro ng bagong bola para sa kanilang basketball game.

35. Musk has been vocal about his concerns over the potential dangers of artificial intelligence.

36. Kailangang di niya malimutan ang araw na ito.

37. Me encanta enviar tarjetas de amor en el Día de San Valentín a mis amigos y seres queridos.

38.

39. Nang malapit na siya, nagtatakbo ang dalaga at nawalang parang bula.

40. And often through my curtains peep

41. Las escuelas pueden ser administradas por el gobierno local, estatal o federal.

42. La pièce montée était absolument délicieuse.

43. The United States is a culturally diverse country, with a mix of ethnicities, languages, and religions.

44. Forgiveness is a choice that can bring healing and peace to both the forgiver and the one being forgiven.

45. Kelahiran di Indonesia biasanya dianggap sebagai momen yang sangat penting dan bahagia.

46. Si Ben ay malilimutin pagdating sa mga petsa ng okasyon, kaya lagi siyang may kalendaryo.

47. Superman possesses incredible strength and the ability to fly.

48. Pabili ho ng isang kilong baboy.

49. He is also relieved of the burden of needless expenses and ultimately becomes a happier and healthier citizen

50. Eksport af forskning og udvikling er en vigtig del af den danske økonomi.

Recent Searches

napakabilistraditionalnangingilidhuertoroofstockwakasipagmalaakibinatilyo1960smalawakrecibiro-orderbundokhagdanaaisshpromotetinikiskedyullipadiigibkasalanankumukulobusogcapitalbangkoskypeewanikinalulungkotcenterprinceredigeringreplacedduonbernardofialayasmabilisdetteeffortsproperlycongressboboestablishtsefeeljacesinongzoompedromeanmabutingstatestoplightnag-iinompatawarinipaliniscommerceaggressionhelloenvironmenthapasinmultoleaderrors,broadcastingseparationmusicalesredespabulongsumalameansmagkakasamatotoonghelpfulnaghandalumuwasloobclimbededukasyontagakmasaraptatlongpagsasayakasokinapanayamngunitpotaenaculturakinakitaangeologi,gayunpamantobaccomanggagalingnanahimikpangungutyakumakalansingbaranggaypagtawasagasaanfilipinamahiwaganaguguluhangkinakabahanbefolkningen,naiyaktaga-suportanagsagawatahimiknagdadasalnakataaskongresonagagamitkulunganmagbibiladpagdudugotumiratelephonegumigisinghagdananusuarioumiibigpumulotpamagatpaghangavidenskabpinigilanadvancementrespektivekirbysinoindustriyamatagumpaypapalapitculturesmalalakiperseverance,disciplinsunud-sunodtagumpayde-latabutterflybantulotpagkababatuyomakisuyonagpagawagulatbuhoksinakopnararapatmaatimisinumparememberedbobotobumangontondohuwebesyatasenioralaykinantamalikotsonidopresleynakinigyephojasisinalangmakasarilingletterparokrustransmitidasopokonsultasyonstillatininantokbagyobrindarsansabihingmaisburmafeelingbigpartdinmindtabistonehamworrygenerationerjeromevedmommybumugapag-iinatgreendeath