Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

28 sentences found for "research,"

1. Additionally, be aware that not all opportunities on the internet are legitimate, so always do your own research before investing time or money into any opportunity

2. Ailments can be a source of inspiration for medical research and innovation to develop new treatments and cures.

3. But the point is that research in the field of the development of new energy sources must be carried on further and expedited so that the exhaustion of conventional sources of power does not adversely affect the growth of our economy and the progress of civilization

4. Cancer is a complex disease, and ongoing research and collaboration are essential for developing new treatments and improving patient outcomes

5. Cancer research and innovation have led to advances in treatment and early detection.

6. Einstein's legacy continues to inspire and influence scientific research today.

7. Hiram na libro ang ginamit ko para sa aking research paper.

8. Hospitalization can provide valuable data for medical research and innovation, leading to improved treatments and outcomes for future patients.

9. In conclusion, making a book is a creative and fulfilling process that requires planning, research, and hard work

10. Investing in the stock market can be risky if you don’t do your research.

11. Leukemia research continues to improve our understanding of the disease and develop more effective treatments.

12. Microscopes are commonly used in scientific research, medicine, and education.

13. Microscopes have helped us to better understand the world around us and have opened up new avenues of research and discovery.

14. Microscopes have played a critical role in the development of modern medicine and scientific research.

15. Musk has donated significant amounts of money to charitable causes, including renewable energy research and education.

16. Oscilloscopes are commonly used in electronics, telecommunications, engineering, and scientific research.

17. Quiero hacer una contribución significativa a la ciencia a través de mi investigación. (I want to make a significant contribution to science through my research.)

18. Research and analysis are important factors to consider when making investment decisions.

19. Research on viruses has led to the development of new technologies, such as CRISPR gene editing, which have the potential to revolutionize medicine and biotechnology.

20. Research: Depending on the subject of your book, you may need to conduct research to gather information and support your ideas

21. Scientific research has led to the development of life-saving medical treatments and technologies.

22. Scientific research has shown that meditation can have a positive impact on mental health.

23. Scientific research has shown that regular exercise can improve heart health.

24. She donated a significant amount to a charitable organization for cancer research.

25. Stock market investing carries risks and requires careful research and analysis.

26. The news might be biased, so take it with a grain of salt and do your own research.

27. The United States is a global leader in scientific research and development, including in fields such as medicine and space exploration.

28. The versatility and precision of oscilloscopes make them indispensable tools for electronic design, testing, and research.

Random Sentences

1. Tila nagbago ang ihip ng hangin matapos ang kanilang pag-uusap.

2. Gusto ko ang mga bahaging puno ng aksiyon.

3. Nagbiyahe ako sa Mindanao noong isang taon.

4. Lahat ay nakatingin sa kanya.

5. People who give unsolicited advice are a dime a dozen.

6. Walang kasing bait si daddy.

7. The role of a wife has evolved over time, with many women pursuing careers and taking on more equal roles in the household.

8. Sa pangkat na iyon ay kay Ogor agad natutok ang kanyang tingin.

9. Be my girl, Jacky. bulong niya sa tenga ko.

10. Maaaring magdulot ng sakit sa kalooban ang mga dental problem, kaya't mahalagang agapan ito upang maiwasan ang mas malalang kalagayan.

11. Umiling ako. Hindi naman po. nakangiti ko pang sagot.

12. Det kan være en udfordrende tid at blive voksen og kvinde.

13. Ultimately, the concept of God is deeply personal and subjective, with each person's beliefs and experiences shaping their understanding of the divine.

14. Puwede ba kitang yakapin?

15. Hindi ako komportable sa mga taong nagpaplastikan dahil alam kong hindi nila ako tunay na kakampi.

16. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

17. In recent years, the Lakers have regained their competitive edge, with the acquisition of star players like LeBron James and Anthony Davis.

18. Min erfaring har lært mig, at det er vigtigt at have en god arbejdsetik.

19. The early bird catches the worm.

20. Ang salarin ay nahuli matapos ang matagal na manhunt ng mga awtoridad.

21. Las serpientes son animales solitarios y, en su mayoría, evitan el contacto con los humanos.

22. Las aplicaciones móviles permiten el acceso a internet desde cualquier lugar.

23. Tanggalin mo na nga yang clip mo!

24. The foundation's charitable efforts have improved the lives of many underprivileged children.

25. Libag ang tawag sa duming kumakapit sa katawan na karaniwang galing sa alikabok

26. Mathematical formulas and equations are used to express relationships and patterns.

27. Ang hirap naman ng exam nakaka bobo.

28. Sa bawat kumpetisyon, ipinapakita ni Carlos Yulo ang kahusayan at disiplina ng isang atletang Pilipino.

29. Sa kulturang Pilipino, ang punong-kahoy ay kinikilala bilang simbolo ng kalikasan at pagiging matatag.

30. Ako'y napatingin sa dalagang nababalot ng hiwaga

31. Dali na, ako naman magbabayad eh.

32. No deberías estar llamando la atención de esa manera.

33. Masaya ang buhay kapag mayroong kaulayaw na handang tumulong sa iyo.

34. Da Vinci murió en Francia en el año 1519.

35. Las hojas del libro están todas marcadas con notas adhesivas.

36. Tila wala siyang naririnig.

37. Wag ka nang malumbay dahil nandito naman ako.

38. Women have faced discrimination and barriers in many areas of life, including education and employment.

39. Sang-ayon ako na dapat natin pagtuunan ng pansin ang kalagayan ng ating kalikasan.

40. Pero pag harap ko, para akong nanigas sa kinatatayuan ko.

41. May basa ng dugo't lupa ang kanyang nguso.

42. Sana makatulong ang na-fund raise natin.

43. Bukod pa sa rito ay nagbigay pa ito ng bitamina sa katawan ng tao.

44. Sadyang naging matagumpay ang kanilang proyekto sa paaralan.

45. Dahil sa magigiting nating bayani, nakamit natin ang araw ng kalayaan.

46. Boboto ako sa darating na halalan.

47. Just because she's quiet, it doesn't mean she's not intelligent - you can't judge a book by its cover.

48. Maingay ang bagong taon sa Pilipinas.

49. Everyone knows that she's having an affair, but nobody wants to talk about the elephant in the room.

50. Vivir con una conciencia limpia nos permite dormir mejor por la noche.

Recent Searches

kauntibiglaanduwendepayapangresearch,kusinanabigayibabawipinambiliisinalaysayhirammadadalaeroplanovaliosanasunogconvey,ipinadakippakisabiapologetichinabolsumimangotpaketeheartbeatparoroonainventadokatolikonapasukoindependentlykundinapilitangnangingitngithunisamang-paladpamimilhingsundaeyourself,utilizar1950skasakitbulaksagapkuyabestidahoysalitangsumisilipbilanginpamamahingamartialbigasubotiniobingomininimizetiketbinatangmalambingbasahinbinasamalumbaymagtipidchooseartistsalamidosakaumaagosprobablementemasdansinipangklimabilhinlatestlasingerosuccessfulsufferrabeterminojokebutihingmassesmaestromenoskamag-anaktonopatunayanelectionluisanigreenitinalimuchosmanuelcondospecializeddogcoaching:congratslulusogmarchformasbuwalbumabahacouldsamamaputitomspeechinspiredclientesmulti-billionbosesipinagbilinglcdkararatingclassroomspaghettiexpertilaninternetflashdependingsettingmanagergapviewpackaginggoingcontentlearneachimprovednamungafencinggenerationsinteriornagwo-workmoreinterpretinglettermaibalikmonsignorneedganyandinukotmananagotnauliniganinnovationdonationsmakalawacanteenpilinggngintroductionpobrengsong-writingnasanakuhamatumalhastakontingdisseautomationindiasorefullmahinognagpabakunaparobabaeropapuntamainitkamaomalamangnalamanfotosnakaraanpangarapdalawmakakasahodsportsnagre-reviewkinagagalaknagngangalangpagpapakalatenergy-coalkumikinignapakasipagtagtuyotmakasilongmagpapagupitmusicianpagkakamalinakalipasisinulatbinge-watchingstyleseksportentinawagtaga-hiroshimafilipina