Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

28 sentences found for "research,"

1. Additionally, be aware that not all opportunities on the internet are legitimate, so always do your own research before investing time or money into any opportunity

2. Ailments can be a source of inspiration for medical research and innovation to develop new treatments and cures.

3. But the point is that research in the field of the development of new energy sources must be carried on further and expedited so that the exhaustion of conventional sources of power does not adversely affect the growth of our economy and the progress of civilization

4. Cancer is a complex disease, and ongoing research and collaboration are essential for developing new treatments and improving patient outcomes

5. Cancer research and innovation have led to advances in treatment and early detection.

6. Einstein's legacy continues to inspire and influence scientific research today.

7. Hiram na libro ang ginamit ko para sa aking research paper.

8. Hospitalization can provide valuable data for medical research and innovation, leading to improved treatments and outcomes for future patients.

9. In conclusion, making a book is a creative and fulfilling process that requires planning, research, and hard work

10. Investing in the stock market can be risky if you don’t do your research.

11. Leukemia research continues to improve our understanding of the disease and develop more effective treatments.

12. Microscopes are commonly used in scientific research, medicine, and education.

13. Microscopes have helped us to better understand the world around us and have opened up new avenues of research and discovery.

14. Microscopes have played a critical role in the development of modern medicine and scientific research.

15. Musk has donated significant amounts of money to charitable causes, including renewable energy research and education.

16. Oscilloscopes are commonly used in electronics, telecommunications, engineering, and scientific research.

17. Quiero hacer una contribución significativa a la ciencia a través de mi investigación. (I want to make a significant contribution to science through my research.)

18. Research and analysis are important factors to consider when making investment decisions.

19. Research on viruses has led to the development of new technologies, such as CRISPR gene editing, which have the potential to revolutionize medicine and biotechnology.

20. Research: Depending on the subject of your book, you may need to conduct research to gather information and support your ideas

21. Scientific research has led to the development of life-saving medical treatments and technologies.

22. Scientific research has shown that meditation can have a positive impact on mental health.

23. Scientific research has shown that regular exercise can improve heart health.

24. She donated a significant amount to a charitable organization for cancer research.

25. Stock market investing carries risks and requires careful research and analysis.

26. The news might be biased, so take it with a grain of salt and do your own research.

27. The United States is a global leader in scientific research and development, including in fields such as medicine and space exploration.

28. The versatility and precision of oscilloscopes make them indispensable tools for electronic design, testing, and research.

Random Sentences

1. Di ko inakalang sisikat ka.

2. Claro, estaré allí a las 5 p.m.

3. The reviews aren't always reliable, so take them with a grain of salt.

4. La música es una parte importante de la

5. Ang daming pulubi sa Luneta.

6. Quien siembra vientos, recoge tempestades.

7. Mapayapa ang kanilang lungsod sa pamumuno ng kanilang butihing Mayor.

8. Det er vigtigt at skabe en inkluderende og støttende samfund for transkønnede personer og bekæmpe diskrimination og intolerance.

9. Ada banyak kitab suci yang berisi doa-doa, seperti Al-Qur'an, Injil, dan Weda.

10. Aplica abono orgánico al suelo para proporcionar nutrientes adicionales a las plantas

11. Muli niyang tiningnan ang nakabulagtang si Ogor.

12. Nay, ikaw na lang magsaing.

13. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

14. Naniniwala ang ilang tao na ang albularyo ay may kakayahang mag-alis ng masamang espiritu.

15. Meryl Streep is considered one of the greatest actresses of all time, with numerous award-winning performances in films like "The Devil Wears Prada" and "Sophie's Choice."

16. Naisip ko ang aking dating kasintahan, datapwat alam kong masaya na siya sa kanyang bagong relasyon.

17. Naaksidente ang aming plano sa bakasyon dahil sa pagbaha sa lugar na aming pupuntahan.

18. Ang pagsasama ng pamilya ay isang nakagagamot na karanasan na nagbibigay ng tunay na kaligayahan.

19. Pinuri ni Pangulong Rodrigo Duterte si Carlos Yulo matapos ang kanyang tagumpay sa gymnastics.

20. Anong kulay ang gusto ni Andy?

21. Magandang araw, sana pwede ba kita makilala?

22. Ano ang gagawin ni Trina sa Disyembre?

23. She was excited about the free trial, but I warned her that there's no such thing as a free lunch.

24. Umalis sa sakayan ang mga pasahero nang limahan.

25. Nationalism has been used to mobilize people in times of war and crisis.

26. Eine hohe Inflation kann zu einem Anstieg der Sozialausgaben führen.

27. Anong klaseng sinigang ang gusto mo?

28. Nanatili siya sa pagkakatayo nang ilang saglit, wari'y tinakasan ng lakas, nag-iisip ng mga nakaraang pangyayari.

29. Sa pagtatapos ng seminar, ang mga dumalo ay nag-aapuhap ng mga kopya ng mga presentasyon.

30. Nagkasakit ka dahil sa kakulangan sa tulog? Kung gayon, kailangan mong magpahinga nang maayos.

31. Natatakot kang mabigo? Kung gayon, huwag mong sayangin ang pagkakataon na subukan.

32. He sought to strengthen border security and pushed for the construction of a border wall between the United States and Mexico.

33. Sa tuwing binabalewala ako ng ibang tao, naglalabas ako ng malalim na himutok sa loob ng aking puso.

34. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

35. Matapos mahuli, nanumpa siya ng katapatan sa Estados Unidos.

36. Ang pagpapa-tanggal ng ngipin ay ginagawa kapag hindi na maaring malunasan ang sira nito.

37. Pero bigla na lang siyang hindi nagpakita.

38. Bakit lumilipad ang manananggal?

39. Sa paaralan, mahigpit na ipinagbabawal ang anumang uri ng abuso laban sa mga mag-aaral.

40. Ano ang gusto mong gawin kapag walang pasok?

41. Cryptocurrency can be used for both legal and illegal transactions.

42. Keep studying and hang in there - you'll pass that test.

43. Dahil sa kahirapan natuto siyang magnakaw at mandukot

44. Facebook Messenger is a standalone messaging app that allows users to have private conversations with friends and contacts.

45. Siguro nga isa lang akong rebound.

46. She has finished reading the book.

47. Nationalism can be both a positive force for unity and a negative force for division and conflict.

48. Lalong nagalit ang binatilyong apo.

49. She attended a series of seminars on leadership and management.

50. Kantahan mo si Noel ng Kumanta ka ng kundiman

Recent Searches

research,namejennyhinanaptalagangdirectapinakawalanboyusolumiwagnapapahintotrenyorkguardaumiinombabapakakasalanbalatlandlineganangmagagandangnatapospatienceandresnakakariniggatolnasasabihangumuhitpamahalaanchoiumiiyakbinuksanpagkuwanimbesmabangisdeletaaspantalongadecuadopalusotnabigkasyongresultakalakihankumaliwanilaydelsersamangayonmagsungitisinalaysaynatakottenerpagsagotayokomultoiniuwistagetinulak-tulakmadungislatestmisusedmakalingskypeendingsafeasignaturapalengkemapagbigaykaynakaliliyongrestideaclassesiintayinsumaliphilosophicalplatoakmakoreaochandoginookanya-kanyangmangahaswhetherjerrytumatanglawloobbornposterpinakamagalingdiinbisitahumihingalprutastextosakanagbababawednesdaycapitalistnakapaligidaniyaduwendepicsbanlagcanadabunsozamboangamagtatakabingogeneibinalitangsayanagpupuntamerrypapasokcigarettesnakabaonmatangumpaykilayentertainmentelectoralsagotlistahanfatrambutanpopcornkontratamaatimhinintaypagkakalapatkahirapanmarahangbusymaasahansparkhumahangosluluwasaudiencenoongminamahalbroadyelonabigaynatayonaabotgapviewnapasukomakamitderbirthdayingatanmandirigmangalapaapmininimizeyumakapmapaikotpaladstruggledgeneratedbugtongoperativosconectandeclareintelligencesundaelansangannag-aaralflashedit:sapotlossconvertingvoteslearnlubosuulaminbumilipinakatuktokpaninigasemocionantebowlcellphonekontramakatulogyumabangginoongkinauupuangmanggagalingmunabio-gas-developingkesogawapawiinmalasutladumilatnagtanghalianpaglingongranada