Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

26 sentences found for "research,"

1. Additionally, be aware that not all opportunities on the internet are legitimate, so always do your own research before investing time or money into any opportunity

2. Ailments can be a source of inspiration for medical research and innovation to develop new treatments and cures.

3. But the point is that research in the field of the development of new energy sources must be carried on further and expedited so that the exhaustion of conventional sources of power does not adversely affect the growth of our economy and the progress of civilization

4. Cancer is a complex disease, and ongoing research and collaboration are essential for developing new treatments and improving patient outcomes

5. Cancer research and innovation have led to advances in treatment and early detection.

6. Einstein's legacy continues to inspire and influence scientific research today.

7. Hiram na libro ang ginamit ko para sa aking research paper.

8. Hospitalization can provide valuable data for medical research and innovation, leading to improved treatments and outcomes for future patients.

9. In conclusion, making a book is a creative and fulfilling process that requires planning, research, and hard work

10. Leukemia research continues to improve our understanding of the disease and develop more effective treatments.

11. Microscopes are commonly used in scientific research, medicine, and education.

12. Microscopes have helped us to better understand the world around us and have opened up new avenues of research and discovery.

13. Microscopes have played a critical role in the development of modern medicine and scientific research.

14. Musk has donated significant amounts of money to charitable causes, including renewable energy research and education.

15. Oscilloscopes are commonly used in electronics, telecommunications, engineering, and scientific research.

16. Quiero hacer una contribución significativa a la ciencia a través de mi investigación. (I want to make a significant contribution to science through my research.)

17. Research and analysis are important factors to consider when making investment decisions.

18. Research on viruses has led to the development of new technologies, such as CRISPR gene editing, which have the potential to revolutionize medicine and biotechnology.

19. Research: Depending on the subject of your book, you may need to conduct research to gather information and support your ideas

20. Scientific research has led to the development of life-saving medical treatments and technologies.

21. Scientific research has shown that meditation can have a positive impact on mental health.

22. Scientific research has shown that regular exercise can improve heart health.

23. Stock market investing carries risks and requires careful research and analysis.

24. The news might be biased, so take it with a grain of salt and do your own research.

25. The United States is a global leader in scientific research and development, including in fields such as medicine and space exploration.

26. The versatility and precision of oscilloscopes make them indispensable tools for electronic design, testing, and research.

Random Sentences

1. The surface of the football field can vary, but it is typically made of grass or artificial turf.

2. Musk has faced criticism over the safety of his companies' products, such as Tesla's Autopilot system.

3. Technology has also played a vital role in the field of education

4. Ako si Minervie! Ang dyosa ng dagat! Dahil sa kasamaan mo, parurusahan kita! Simula ngayon, hindi ka na maglalakad sa lupa

5. Binasa niya ang balikat, ang mga bisig.

6. Hindi ko alam kung sino ang unang naisip na bigyan ng pangalan ng Bukas Palad ang kanilang grupo ng musika, ngunit ito ay tunay na nakakainspire.

7. Pinili kong magtrabaho mula sa bahay upang makasama ang aking mga anak, bagkus may mga oras na rin na kailangan akong pumasok sa opisina.

8. Frohe Weihnachten! - Merry Christmas!

9. Nauntog si Jerome sa kanilang pintuan.

10. Hospitalization can have a significant impact on a patient's mental health, and emotional support may be needed during and after hospitalization.

11. Real estate investing: Invest in real estate through online platforms like Fundrise or Roofstock

12. Nagtago kami sa lilim ng malaking bato habang naghihintay sa pagtatapos ng ulan.

13. Ang mga tagapangasiwa sa komunidad ay nag-organisa ng isang pulong upang tanggapin ang mga mungkahi ng mga residente.

14. The role of God in human affairs is often debated, with some people attributing all events to divine intervention and others emphasizing the importance of human agency and free will.

15. Baby fever is a term often used to describe the intense longing or desire to have a baby.

16. Sa loob ng isang saglit, hindi niya maulit na salatin ang biyak na pisngi.

17. Les encouragements et les récompenses peuvent être utilisés pour motiver les autres, mais il est important de ne pas les rendre dépendants de ces stimuli.

18. Gusto kong ibigay ang aking buong atensyon sa aking nililigawan upang malaman niya na tunay kong mahal siya.

19. Sa buwan ng Mayo ang kaarawan ko.

20. Meskipun tantangan hidup kadang-kadang sulit, tetapi mereka juga dapat memberikan kepuasan dan kebahagiaan ketika berhasil diatasi.

21. Nakisakay ako kay Jose papunta sa airport.

22. La realidad siempre supera la ficción.

23. La boda de mi amigo fue una celebración inolvidable.

24. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

25. Gusto mo bang maglaro ng basketbol?

26. Lumitaw ang kagandahan ni Marie matapos syang mabihisan.

27. Gaano ka kadalas pumunta sa doktor?

28. Amazon's Prime membership program offers many benefits, including free shipping, access to streaming video and music, and more.

29. Ang hindi magmahal sa sariling wika ay higit pa sa hayop at malansang isda.

30. The value of stocks can rise or fall depending on a company's financial performance and market conditions.

31. Minsan lang ako nag mahal ng ganito.

32. Mainit sa Pilipinas sa buwan ng Abril.

33. Si Juan ay nagiigib ng tubig mula sa poso para sa mga halaman sa hardin.

34. The bridge was closed, and therefore we had to take a detour.

35. Ang mga magsasaka ay nagtatanim ng palay.

36. Awang-awa ang maraming katutubo sa pagpapasan sa krus si Padre Novelles.

37. Elektronikken i et hjem kan hjælpe med at forbedre komfort og livskvalitet.

38. La internet nos permite comunicarnos con personas de todo el mundo a través de correo electrónico, redes sociales y otros medios.

39. Paglabas niya ng bahay, nabigla siya nang biglang umambon ng malakas.

40. Tinanggal ko na yung maskara ko at kinausap sya.

41. Kaninong payong ang asul na payong?

42. Siya si Helena, nag-iisang anak siya nina Haring Bernardo at Reyna Lorena.

43. A caballo regalado no se le mira el dentado.

44. Tuwing mayo kung ganapin ang eleksyon.

45. Ang manunulat ay nagsusulat ng nobela na nagpapakita ng kaniyang malikhain na imahinasyon.

46. Pagkatapos kong maglaba ay pupunta na ako sa mall.

47. I saw a beautiful lady at the museum, and couldn't help but approach her to say hello.

48. Tesla vehicles are known for their acceleration and performance, with the Model S being one of the quickest production cars in the world.

49. Napaka presko ng hangin sa dagat.

50. Ang pagtanggi sa mga ebidensya ay nagpapakita ng pagiging bulag sa katotohanan.

Recent Searches

research,makikipaglarokasiyahannag-iisipdiagnoseslutokumampianitonamilipitadverselyorastag-arawlangkaydotalupanghapag-kainaninalalayantanonghandatunaydiagnosticpinilingriyanenfermedades,nanggigimalmallikodkurbataluisrizalnagpatimplamangangahoynagsagawaherramientakailanmanganyandolyarmauliniganniyangaanoclientsmalimitnagtitiisnamasyalabstainingpinagbigyanfindesilid-aralanmuntingsinoisasamatreatstataasbakunatumingintotoongkaliwangbalatformasbillilognalalabietopaumanhinschoolsdaraandamitdingdingreducedpunomasipagcitearbejderkailangangganitolumbayhadlangislatuladnakatalungkoeachnakakatakotconsiderdyipnielepantevillageguhittwopaglalabananedadeksperimenteringinaantaysakimtenderpersonsuedematangkadtinulak-tulakangalduwendeticketiiyakcomebesesmailapplasmamaramikalagayanpalibhasaulanchumochoskirotsurgeryabalapalagidanskenatatawananoodtodaskayoipakitanangcorrientesmaglutodagokpagguhitradiomaya-mayaintroducekombinationnakasabitjunionazarenotrajeprinsesakinagattinanongsabihingratificante,rinkinasuklamanmabigyankinaumagahanpanimbangnegro-slavespananimdemocracykaguluhancubicleunitedlikasamericanibadahilelectoralinstrumentallasongmagsasakakamag-anaknaiilaganlumangoykasawiang-paladlagaslasdali-dalingisdanglastingmataposbrasokaininconventionalsikrer,becomessanainternayakapbakenapatigninlumiwageducatingbuhawisasambulatkungbefolkningentiyakansiyamdatacashnalalagasmagbigaynapakabagalmadurasnag-eehersisyoestablisimyentonakapasokpahahanapniyamanunulatentoncesnahuloghuwebesniluto