Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "nagnakaw"

1. Nahuli na kahapon ang nagnakaw ng kalabaw ni Mang Arturo.

Random Sentences

1. La crisis económica produjo una gran inflación que afectó a los precios.

2. "A dog is the only thing on earth that loves you more than he loves himself."

3. Bakit ho, saan ninyo ko dadalhin?

4. A couple of actors were nominated for the best performance award.

5. God is a concept of a supreme being or divine force that is often worshiped and revered by religious communities.

6. Kakain ako ng spaghetti mamayang gabi.

7. Las redes sociales son una herramienta útil para encontrar trabajo y hacer conexiones profesionales.

8. Maramot ang bata sa laruan kaya walang gustong makipaglaro sa kanya.

9. Hindi ako sang-ayon sa pamamaraan na ginagamit mo upang maabot ang iyong mga layunin.

10. Pinagtabuyan ng mga mababangis na hayop at ng mga ibon ang kawawang si Paniki.

11. Sa kabila ng mahigpit na bantay, nangahas silang tumakas mula sa kampo.

12. Sa kabila ng pag-iisa, may mga taong handang tumulong sa kaniya.

13. Hindi ko alam kung paano mo ito tatanggap, pero may gusto ako sa iyo.

14. She prepares breakfast for the family.

15. The chef created a series of dishes, showcasing different flavors and textures.

16. Ese vestido rojo te está llamando la atención.

17. Hang in there and stay focused - we're almost done.

18. Elektronikken i en bil kan hjælpe med at forbedre kørsel og sikkerhed.

19. Format your book: Once your book is finalized, it's time to format it for publication

20. Modern civilization is based upon the use of machines

21. Matagumpay akong nakapag-alaga ng mga halaman kaya masayang-masaya ako ngayon.

22. Sa pagtulog, ang utak ay nagpapahinga at nagpaproseso ng mga impormasyon na natutunan sa buong araw.

23. Después de desayunar, salgo a correr en el parque.

24. Gumawa si Mario ng maliit na bola mula sa papel.

25. La publicidad en línea ha permitido a las empresas llegar a un público más amplio.

26. But all this was done through sound only.

27. El curry tiene un sabor picante y aromático que me encanta.

28. Tumingin muna si Tarcila sa asawa at...

29. Magkakasama ang mga damit nila nina Kano, Boyet at Diding.

30. Ngunit kahit ganyan ang kinalalagyan.

31. The patient's family history of leukemia increased their risk of developing the disease.

32. In the early days, telephones were connected to a central switchboard, which connected calls manually

33. Lazada's influence on the e-commerce industry in Southeast Asia is significant, and it is likely to continue to be a major player in the years to come.

34. Guten Morgen! - Good morning!

35. Electric cars can help reduce dependence on foreign oil and promote energy independence.

36. In the years following his death, Presley's legacy has continued to grow

37. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

38.

39. Thomas Jefferson, the third president of the United States, served from 1801 to 1809 and was the principal author of the Declaration of Independence.

40. His first hit, That's All Right, was released in 1954 and quickly climbed the charts

41. Kalahating pulgada ang kapal ng pakete.

42. Magmula noon nakilala na sa Palawan ang pating.

43. Cryptocurrency can be used for peer-to-peer transactions without the need for intermediaries.

44. La paciencia es necesaria para alcanzar nuestros sueños.

45. When I'm traveling alone, I often join a group tour to break the ice and meet new people.

46. The stock market can provide opportunities for diversifying investment portfolios.

47. Ang aming mga pangarap at layunin ay pinagsasama namin bilang magkabilang kabiyak.

48. Medyo napalakas ang pag kakauntog nya sa pader.

49. Sa pagguhit, puwede ka rin mag-experiment ng iba't-ibang kulay at matutunan ang mga color combinations.

50. Skolegang er en vigtig del af børns opvækst og udvikling.

Recent Searches

makitaeskwelahannamumulotnagpalalimnagsagawanagnakawnapakahusaypulang-pulanagbabasatabihanmakaraanmakakibopagkaangatngumiwinagsuotdeliciosanahintakutantatayomabihisanuugod-ugodpangungusapnakikiamanghikayatginawarantotoogawainkasamaangnatanongiikutanwriting,intindihinnanunuksotemperaturanaglokohanpatakbomahuhulinakapikithanapinkusinanapakahinampasteachingskargahancynthiaxviiniyonpaliparinbinabaratbusiness:isiplazadao-orderpagkaingtiyantanganaaisshbuhoktasamagdilimrecibirpaggawaomfattendenayoniskedyulsiglokalongsoundnogensindemagbigayanpagkatarkilapangkatreviewnatagalanangalpublishing,lingidreplacedwalngexcusefamewariflaviobilugangcalciumbangkogaggodtnoelplasmaginisingoutperangnagbungarhythmpagbahingwordskamipartybernardoparagraphsbilinpinyafiaconstitutionpdaauthorfataltraininghatingpaslitioslorenaredstrategydeleencounterheitumalonwhilerangestringsettingjunjuninfinitypacebitbitplatformmanagerpracticesandycommercehellomay-arisinunodanlaborecentlymakakakaenproducererenergisignal1973maghahabitoylagaslasnagbakasyonluluwasnagtungophilanthropytaga-hiroshimagitaranunlumilipadkagipitannakangisinggovernorsngpuntaitinagopigingpangakonamadangerousclaseslandoagosgamotmaranasananteskontratirangginoongpagpalittiniklingagetiliuwakreportumokaysaktanbugtongnagreklamoflyvemaskinermagsasakaisasabadmirameriendanag-iinombabasahinpagpasensyahanleksiyonngingisi-ngisingkahongnapakatagalmagtagomagtatanimbulakmahuhusaynakatagopasyentenaiilang