Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

2 sentences found for "shock"

1. His death was a shock to the world, and millions of fans mourned the loss of one of the most important figures in the history of American music

2. His death was a shock to the world, and millions of fans mourned the loss of one of the most important figures in the history of martial arts

Random Sentences

1. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

2. Nang simula ay hindi napuputol ang komunikasyon ng magkasintahan, araw araw na sumusulat ang binata sa dalaga at ganoon din naman ang dalaga.

3. Ang mga himig ng kundiman ay nagpapalaganap ng mga kuwento ng pag-ibig na hindi matutumbasan ng anumang kayamanan.

4. May mga punong-kahoy na pinaniniwalaang matatanda nang bago pa dumating ang mga kolonizador.

5. Ibinigay ni Ana ang susi sa kanya.

6. Dahil sa pagiging maramot, madalang siyang bisitahin ng kanyang mga kaibigan.

7. He has painted the entire house.

8. Masaya akong napanood ko na live ang pagkanta ng Bukas Palad sa isang fundraising event.

9. Emphasis is often used in advertising and marketing to draw attention to products or services.

10. Nakabalik na kami ni Maico galing sa pinagsanglaan ni Kuya.

11. Sa pamamagitan ng malalim na paghinga at pagsasanay ng pagmameditasyon, ang aking stress ay unti-unti nang napawi.

12. Sumasakit na naman ang aking ngipin.

13.

14. Gaano katagal ho kung sasakay ako ng dyipni?

15. Inakalang totoong kaibigan ang kasama niya, pero pinagsisinungalingan siya.

16. Mabuti pang umiwas.

17. Electric cars can help reduce dependence on foreign oil and promote energy independence.

18. Forgiveness is a virtue that promotes peace, healing, and a greater sense of connection with ourselves and others.

19. Siempre es gratificante cosechar las verduras que hemos cultivado con tanto esfuerzo.

20. Trapik kaya naglakad na lang kami.

21. Bawal magpakalat ng mga labis na pamahiin dahil ito ay nagdudulot ng takot at kawalan ng kaalaman.

22. May nagbigay sa amin ng biglaang free food sa opisina kanina.

23. Today, Presley is widely considered to be one of the most important figures in American music and culture

24. Robusta beans are cheaper and have a more bitter taste.

25. Tesla's Powerwall is a home battery system that allows homeowners to store energy for use during peak hours or power outages.

26. Nagmadali akong pumasok sa kalsada nang abutin ko ang dakong huli ng bus.

27. Hawak niya yung kamay ni Gelai habang palapit sa amin.

28. Microscopes have played a critical role in the development of modern medicine and scientific research.

29. The exhibit features a variety of artwork, from paintings to sculptures.

30. Starting a business during an economic downturn is often seen as risky.

31. Los alimentos ricos en nutrientes son fundamentales para mantener un cuerpo sano.

32. El puntillismo es una técnica de pintura que utiliza pequeños puntos de color para crear la imagen final.

33. From: Beast Nasaan ka? Bakit di mo ako hinintay?

34. Pero kahit marami ang sumunod sa itinuturo ng paring Espanyol ay may isang barangay na bulag pa ring sumasamba sa mga anito.

35. Los héroes son modelos a seguir para las generaciones futuras.

36. Eh gaga ka pala eh, gag show mo mukha mo.

37. Fødslen kan også være en tid med stor frygt og usikkerhed, især for førstegangsforældre.

38. La esperanza es el combustible que nos impulsa a seguir adelante cuando todo parece perdido. (Hope is the fuel that drives us forward when all seems lost.)

39. The momentum of the ball was enough to break the window.

40. Baby fever can impact relationships, as partners may have different timelines or desires regarding starting a family.

41. Børns leg og kreativitet er en vigtig del af deres udvikling.

42. Spillene kan også være afhængige af held, dygtighed eller en kombination af begge dele.

43. Det er også vigtigt at varme op før træning og afkøle efter træning for at reducere risikoen for skader.

44. Sa pagbisita sa hardin, ang mga bulaklak ay nagbigay ng mabangong amoy at kagandahan sa kapaligiran.

45. In 2014, LeBron returned to the Cleveland Cavaliers and delivered the franchise's first-ever NBA championship in 2016, leading them to overcome a 3-1 deficit in the Finals against the Golden State Warriors.

46. La inversión en la agricultura es importante para apoyar a los agricultores y la producción de alimentos.

47. La comida tailandesa es famosa por su sabor picante.

48. When in Rome, do as the Romans do.

49. Practice makes perfect.

50. Sa loob ng aking dibdib, nagliliyab ang poot na pilit kong iniipon.

Recent Searches

shockislamasaksihangumagamithanapinkusinanapanoodumuponatinagikinatatakotnaibibigaymag-inakinikitaeksempeljingjingkanginamagdamaganprobinsyavariedadboyfriendbinawianalassoccerphilippinekatedralmaliitthanktengakarangalanmananahipulisabispeechescollectionsburdennyamariegandatoretesoonso-calledpaslitmagkakailacomepinagawachesspagdudugoalamnananalongmalapalasyocorrectingpioneersharefuturetitaexpectationsquicklyvasquesnalugmokipinalutoatensyongsummitmagkaibangmagpakasaltinawagtotoongtumirahayaangnecesarioseguridadpagkakalutonagpapakainmakukulaymanlalakbaypandidirivedvarendecombatirlas,maibigaysiyangculturesnakangisingsakenkulturcantidadhagdanannaghubadkaliwabighanipinangalananbefolkningenpagbigyannaghihirapnaramdamanmahuhulisimonbinitiwanmagpa-pictureenhederkinumutanvaccinessusunodcriticsilonghistoryreservationtablehabitsnuevoslever,babykonsyertofionaipinasyangaguamaghatinggabiboholtagakkumaensarongkumustabihasapalapagrevolutionizedbiyerneskakayanangsetyembrelayuanmrsmalumbayisinalangchildrenmagkasinggandabumabaggraphicnahigascottishanihinparihinigitnogensindekagandakasaysayanbasahinincidenceanito1954apoysecarseclientesviewsspeechblazingxiximagingcomunesbulsacryptocurrency:promotingballdinalawnalasing1980landasmarsogelaiikinalulungkotgamemaramiinalokmajorkalikasangalitanimoguiltyinfluenceprovidedactionprogramacomputerestartedbabesolidifygitanashateaffectlutuininformedgalinghighesticonsactorinaapiheftymanamis-namisnagkakatipun-tiponmakalaglag-pantydiwatangdahilawitnagmakaawa