Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

7 sentences found for "true"

1. I don't know if it's true or not, so I'll take it with a grain of salt until I have more information.

2. Sleeping Beauty is a princess cursed to sleep for a hundred years until true love's kiss awakens her.

3. The value of a true friend is immeasurable.

4. The Wizard of Oz follows Dorothy and her friends—a scarecrow, tin man, and lion—as they seek the wizard's help to find their true desires.

5. Thumbelina is a tiny girl who embarks on a journey to find true love and her place in the world.

6. True forgiveness involves genuine empathy and a willingness to see the humanity and potential for change in others.

7. Whether you are writing for personal satisfaction or to share your knowledge with others, the most important thing is to stay true to your message and to not give up on your dream of becoming a published author

Random Sentences

1. Papuntang Calamba ang dilaw na bus.

2. Ang pag-akyat ng presyo ng mga bilihin ay nagdulot ng masusing pag-aalala at ikinalulungkot ng maraming pamilya.

3. Sa paggamit ng mga kagamitan, huwag magpabaya sa tamang pag-aalaga at pagpapanatili nito.

4. Sa mga liblib na lugar, ang mga punong-kahoy ay nagbibigay ng sapat na kahoy para sa mga pangangailangan sa konstruksiyon at pang-araw-araw na gawain.

5. Waring hindi pa tapos ang laban, kaya hindi kami dapat magpabaya.

6. Insider trading and market manipulation are illegal practices that can harm the integrity of the stock market.

7. He forgot his wallet at home and therefore couldn't buy lunch.

8. La poesía de Neruda tiene una elegancia sublime que conmueve al lector.

9. Les maladies mentales sont souvent mal comprises et stigmatisées dans de nombreuses cultures.

10. El agua es un símbolo de pureza, vida y renovación.

11. Padabog akong umupo habang dumadating na yung order nya.

12. Hinabol kami ng aso kanina.

13. La película produjo una gran taquilla gracias a su reparto estelar.

14. I set my alarm for 5am every day because I truly believe the early bird gets the worm.

15. They have been friends since childhood.

16. Kung siya ay salamangkero, bakit hindi niya ginamit ang kapangyahiran niya sa akin?

17. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

18. Despite the many advancements in television technology, there are also concerns about the effects of television on society

19. Los días de fiesta populares durante el invierno incluyen la Navidad y el Año Nuevo.

20. Limitations can be perceived as weaknesses, but they can also be strengths and opportunities for growth.

21. Me cuesta respirar. (I have difficulty breathing.)

22. The United States has a system of checks and balances, where each branch of government has the power to limit the power of the other branches

23.

24. Bilang paglilinaw, ang sinabi kong deadline ay sa Biyernes, hindi sa Sabado.

25. Drømme kan inspirere os til at være vores bedste selv og opnå vores fulde potentiale.

26. Hockey has a rich history and cultural significance, with many traditions and customs associated with the sport.

27. Det er en metodisk tilgang til at forstå verden omkring os og finde årsager til de fænomener, vi observerer

28. Ang pagtanggap ng mga bisita at pagkakaroon ng masayang kasiyahan ay bahagi ng mga tradisyonal na okasyon sa Chinese New Year.

29. Napatayo si Magda sa bangka, dahil alam niyang hindi marunong lumangoy ang dalawang bata.

30. Ang mga hudyat ay maaaring maging bahagi ng kultura at lipunan, na may iba't ibang kahulugan sa iba't ibang konteksto.

31. The goal of investing is to earn a return on investment, which is the profit or gain earned from an investment.

32. Las hojas de los cactus son muy resistentes y difíciles de cortar.

33. Les salaires varient considérablement en fonction des métiers et des secteurs d'activité.

34. Mathematics is an ever-evolving field with new discoveries and applications being made constantly.

35. Upang makatiyak, isinama ng datu ang pinakamatapat na kawal nang dumating ang ikatlong gabi.

36. Tila malungkot siya ngayon, ngunit hindi niya sinasabi kung bakit.

37. The officer issued a traffic ticket for speeding.

38. Ang pagiging malilimutin ni Ana ay laging nagdadala ng problema sa kanilang grupo.

39. Nice meeting you po. automatic na sabi ko.

40. Tuluy-tuloy niyang tinungo ang hagdan.

41. The diverse neighborhoods of Los Angeles, such as Chinatown, Little Tokyo, and Koreatown, offer unique cultural experiences and culinary delights.

42. Many people think they can write a book, but good writers are not a dime a dozen.

43. Ni lumapit sa nasabing puno ay ayaw gawin ng mga taong bayan.

44. But recently it has been detected that the habit of smoking causes different kinds of serious physical ailments, beginning with coughing, sore throat, laryngitis, and asthma, and ending with such a fatal disease as cancer

45. Babyens første skrig efter fødslen er en betydningsfuld og livgivende begivenhed.

46. Naaalala mo pa ba noong tayo pang dalawa.

47. Si Hidilyn Diaz ay tinawag na “Pambansang Bayani” sa larangan ng palakasan.

48. Hindi lang militar ang nakikinabang sa digmaan, maaari rin itong magbigay ng oportunidad sa mga negosyante.

49. Ang mga guro ay humingi ng mga mungkahi mula sa kanilang mga mag-aaral upang mapabuti ang kanilang pagtuturo.

50. The Serengeti National Park in Tanzania is a natural wonder renowned for its wildlife and annual migration.

Recent Searches

truepdaauthorpagpapautangpinagtabuyanaeroplanes-allbefolkningendingtuyojosepanokayodyipsikotaaskainmulikatapatsharkcreditngisiahitbilibmestpara-parangnapakahusaynagsagawadraybercanulamtillplannapanaiilangpamilyapaglalabapag-aaralnakakuhamedya-agwalandaslansanganitinaobanak-pawisnangingitngitcarbonnahihilokindsnginingisihanpangingimiindustrybusyanopakiramdamdadalhinbilinwalnglordleomalakiyankartondownsumanghabakaysiyangexplainpagsasalitaandynerissafigureipinadakipbiocombustiblesbaitnagpalalimclassroomnilalangsingsinglimosmanoodgeologi,kumalantogkalalarocourtroofstockplantaspaglisanmatulunginnatitirangtangingmananahieksenasundaepagkaingheartbeatmabilistwitchpinsanhalu-halotinginmahihirapcongratsbernardoandrewresponsiblehapasinmansanasperseverance,natatawaprovematatandanakiramaypagpasensyahanrebolusyonkuwartokahitginagawailigtasmangingisdangkakataposaanhincurtainsriyanbayanirimasnakasabitvaccinesmariosobratindakamoteenglandpumatol11pmgivepamannagingadditionallyjuniowouldkakuwentuhannanghahapdinaninirahankinapanayamnagpaiyakmagbayadnamumulotnakangisiiwinasiwasyakapiniyongumiisodlumutanghurtigerefysik,mabagalcanteeniniirogsociety1960sbefolkningen,baliwaabotvalleyindividualsconsisthousepropesorrhythmdidinglimitaddpopulationstatingmanagershoulditemsditohinugotsenadornakapagngangalitmagnakawkinatatalungkuangkumakalansingnabalitaanbaranggaydinigkalaunanlinggongnaabutantheregayundinmanahimikilalagaybarcelonatsonggongipingpagkagustohabitkakayanang