Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

7 sentences found for "true"

1. I don't know if it's true or not, so I'll take it with a grain of salt until I have more information.

2. Sleeping Beauty is a princess cursed to sleep for a hundred years until true love's kiss awakens her.

3. The value of a true friend is immeasurable.

4. The Wizard of Oz follows Dorothy and her friends—a scarecrow, tin man, and lion—as they seek the wizard's help to find their true desires.

5. Thumbelina is a tiny girl who embarks on a journey to find true love and her place in the world.

6. True forgiveness involves genuine empathy and a willingness to see the humanity and potential for change in others.

7. Whether you are writing for personal satisfaction or to share your knowledge with others, the most important thing is to stay true to your message and to not give up on your dream of becoming a published author

Random Sentences

1. Lügen haben kurze Beine.

2. La esperanza nos ayuda a superar los obstáculos y desafíos que se presentan en nuestro camino. (Hope helps us overcome the obstacles and challenges that come our way.)

3. Throughout history, technology has played a vital role in shaping human civilization and has had a profound impact on society

4. Tu peux me passer le sel, s'il te plaît?

5. Proper training and socialization are essential for a well-behaved dog.

6. Emphasis can also be used to create a sense of urgency or importance.

7. Magandang umaga Mrs. Cruz

8. Nakahug lang siya sa akin, I can feel him..

9. She writes stories in her notebook.

10. Dwyane Wade was a key player in the Miami Heat's championship runs and known for his clutch performances.

11. Foreclosed properties may be sold in as-is condition, which means the buyer may have to make repairs or renovations.

12. El agua es un símbolo de pureza, vida y renovación.

13. Tinanggap niya ang lahat ng ito at marami pang iba sa kaniyang kaarawan.

14. Biglang nagtinginan sila kay Kenji.

15. O-order na ako. sabi ko sa kanya.

16. His teachings continue to inspire and guide martial artists of all styles, and his films continue to be popular today

17. He used credit from the bank to start his own business.

18. Hindi ho ba madilim sa kalye sa gabi?

19. Eating healthy is essential for maintaining good health.

20. Naglipana ang mga ibon sa hardin ngayong tag-araw.

21. Tengo tos seca. (I have a dry cough.)

22. Malakas ang hangin kung may bagyo.

23. Nous avons eu une danse de mariage mémorable.

24. They have already finished their dinner.

25. Si Hidilyn Diaz ay nagtayo ng weightlifting gym upang suportahan ang mga susunod na henerasyon ng atletang Pilipino.

26. Mahirap magsalita nang diretsahan, pero sana pwede ba kita ligawan?

27. Kapag nalulong ka na sa droga, mahirap nang magkamit ng kaganapan sa buhay.

28. Ang kamatis ay mayaman din sa vitamin C.

29. Después de la entrevista de trabajo, recibí la oferta de empleo.

30. Ang buhawi ay maaaring magdulot ng malawakang pinsala sa mga ari-arian, gusali, at mga taniman.

31. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

32. Gaano ka kadalas uminom ng bitamina?

33. Les enseignants peuvent dispenser des cours de rattrapage pour les élèves qui ont des difficultés à suivre les cours.

34. Ang mga punong-kahoy ay kadalasang tinatanim bilang mga pampaganda sa mga pampublikong lugar tulad ng parke o plaza.

35. Unti-unti na siyang nanghihina.

36. May limang estudyante sa klasrum.

37. Scissors can be stored in a scissor case or stand to keep them organized and easily accessible.

38. Anong ginawa nya sayo? Sya ba nagpaiyak sayo?

39. The culprit behind the cyberattack on the company's servers was traced back to a foreign country.

40. Bumuhos ang pawis niya sa sobrang gutom at naglalaway na siya.

41. El maíz necesita sol y un suelo rico en nutrientes

42. Pumitas siya ng bunga at pinisil ito hanggang sa lumabas ang laman.

43. Nagalit ang matanda at pinalayas ang babaeng madungis.

44. Ang mga pag-aaral sa kalusugang pang-mental ay nagbibigay-diin sa kahalagahan ng kamalayan sa mga isyu ng mental na kalusugan.

45. En sund samvittighed kan hjælpe os med at tage ansvar for vores liv og handlinger.

46. Helte findes i alle samfund.

47. Dirk Nowitzki, a 7-foot power forward, is considered one of the best international players in NBA history.

48. Emphasis can help to ensure that a message is received and understood by the intended audience.

49. Pakiramdam ko ngayon ay puno ng inis dahil sa ginawa mo.

50. Electric cars are quieter than gasoline-powered cars due to the absence of an internal combustion engine.

Recent Searches

truecompartenguiltygulangphysicaltumaliwasnakaririmarimsumusunokasaysayanmakikiligoinagawbisikletakristoclearviewspwedestoplightbefolkningen,kalalarokayattorneyumiwaswikaeveningadecuadomaaaringniyaclasesnawalagrinsasthmabasahininalalayanpreviouslykare-kareeksporterercoaching:pangalananmakakakaenkumikilosfertilizerisusuotmatulispropensolutokapatawarankaparehamanmakamittupelonaispagexitlcdmahihirapworkshopnaghihirapideavisualcorrectingbehaviorsambitnapapatinginsynccryptocurrency:nathankumulogdoktormisusedsomenapatulalapoorerparusangpulgadapagsisimbangimpactspanitikantamaddiscouragedninaisdalhinnagtatakboiyamotwalamarahanna-curioustumagaltatlongtalaganakalagayengkantadangdiwatangriniconshesusibabaikinagalitpintobayabaspropesordumatinginspirealaynagulatsweettermbungarosasnaglabadakaliwangmagandanginaaminelenakinumutanbirdstaga-ochandoinilistakanayangkatagatiyakafternoonnahihiyangawitinfysik,karwahengmateryaleskonsyertovideos,friendspinagmamalakielectionsnaghuhukaypermitenpaskongngunithoneymoongabidemocracykalayuanmaabutanmerryroquekoreaseguridadexperts,listahanbossnerovelstandhawaiilayawkawili-wilimaynilawishingsolnagpatulongnagpapanggapkahoysagingpagkabuhayvitalkolehiyocoachingnagtatakarobinhoodsikoinfluencesisinamaplanditobumaligtadsumasakaybinibininatuwanilangpalaypaki-drawingmagtagohalikasinasabiordermasaganangiskedyulkabiyakpearlkanansirformasmagalitpag-unladbalotmarianshinessinunodmandirigmangpakelamritounangmagbaliknamumukod-tangi