Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

7 sentences found for "true"

1. I don't know if it's true or not, so I'll take it with a grain of salt until I have more information.

2. Sleeping Beauty is a princess cursed to sleep for a hundred years until true love's kiss awakens her.

3. The value of a true friend is immeasurable.

4. The Wizard of Oz follows Dorothy and her friends—a scarecrow, tin man, and lion—as they seek the wizard's help to find their true desires.

5. Thumbelina is a tiny girl who embarks on a journey to find true love and her place in the world.

6. True forgiveness involves genuine empathy and a willingness to see the humanity and potential for change in others.

7. Whether you are writing for personal satisfaction or to share your knowledge with others, the most important thing is to stay true to your message and to not give up on your dream of becoming a published author

Random Sentences

1. There were a lot of flowers in the garden, creating a beautiful display of colors.

2. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

3. Ngunit nagliliyab pa rin ang poot sa kanyang mga mata.

4. Maaari mo ng bitawan ang girlfriend ko, alam mo yun?

5. I find that breaking the ice early in a job interview helps to put me at ease and establish a rapport with the interviewer.

6. Sa sinabi nyang yun napalingon ako ng hindi oras, Ha?!

7. Eh bakit nakalock ha?!!! Explain mo nga!

8. Ang abilidad na makisama sa iba't ibang tao ay isang mahalagang aspeto ng liderato.

9. They go to the gym every evening.

10. Hindi sapat na bukas palad ka lang sa mga panahon na kailangan mo ng tulong, dapat bukas palad ka rin sa mga taong nangangailangan ng tulong mo.

11. Bawat galaw mo tinitignan nila.

12. Dansk øl og spiritus eksporteres til mange lande rundt omkring i verden.

13. Oo naman 'My! Walang hihigit pa sa Beauty ko noh.

14. Ang itim mo, Impen! itutukso nito.

15. Have you tried the new coffee shop?

16. Oy bawal PDA dito! natatawang sabi ni Lana.

17. Nag-aaral siya sa library gabi-gabi.

18. She admires the bravery of activists who fight for social justice.

19. The genetic material allows the virus to reproduce inside host cells and take over their machinery.

20. Ang beach resort na ito ay hitik sa mga atraksyon tulad ng mga water sports at spa treatments.

21. Los teléfonos móviles también ofrecen una variedad de funciones adicionales, como la capacidad de enviar y recibir mensajes de texto, tomar fotos, acceder a internet y utilizar aplicaciones

22. Baka makatatlo pa ang kanyang nanay ngayon!

23. Let's just hope na magwork out itong idea ni Memo.

24. Sa aking opinyon, isa sa mga magagaling na mang-aawit sa Pilipinas ay si Bukas Palad.

25. Ano ang paborito mong pagkain?

26. Puwede ba tayong magpa-picture na magkasama?

27. Oscilloscopes come in various types, including analog oscilloscopes and digital oscilloscopes.

28. Nakakasama sila sa pagsasaya.

29. Musk has been married three times and has six children.

30. The singer on stage was a beautiful lady with an incredible voice.

31. They clean the house on weekends.

32. Ang nagtutulungan, nagtatagumpay.

33. James A. Garfield, the twentieth president of the United States, served for only 200 days in 1881 before his assassination.

34. Kebahagiaan sering kali tercipta melalui perspektif positif, menghargai hal-hal sederhana, dan menikmati proses hidup.

35. The United States has a long-standing relationship with many countries around the world, including allies such as Canada and the United Kingdom.

36. Tumayo yung lalaki tapos nakita niya ako.

37. Habang nag-oorasyon nagising si Mang Kandoy dahil sa mga bulong ng salamangkera.

38. The new smartphone model is incredibly lightweight, making it easy to carry around all day.

39. Sa panahon ng kahirapan, mahalaga ang mga kaulayaw na handang magbigay ng suporta.

40. En algunos países, el Día de San Valentín se celebra como el Día del Amigo.

41. Maaliwalas ang panahon kaya itinuloy namin ang piknik.

42. Lalong nagalit ang binatilyong apo.

43. Namnamin mo ang bawat subo ng masarap na ulam.

44. Inflation kann die Arbeitsbelastung der Zentralbank erhöhen.

45. Halos maghalinghing na siya sa sobrang pagod.

46. Nagpamasahe siya sa Island Spa.

47. Upang makatiyak, isinama ng datu ang pinakamatapat na kawal nang dumating ang ikatlong gabi.

48. Sa pagdami ng mga tao, ang mga aso ay naging alaga nila sa kanilang mga tahanan.

49. Haha! Bad mood na bad mood ka ah?

50. Smoking is influenced by various factors, such as peer pressure, stress, and social norms.

Recent Searches

physicaltrueoliviamoodmuchstylesupworkstuffedreturnedsimplenginvolvepantalonnapapasayapamilyangsong-writingestudioumanopupuntahanunahininasikasokumalmanandayabisitakayongyumuyukoskyldes,nareklamogawatumaposnationallipattatlongbaguioisamamagbigayankasoydahan-dahanmayroonitutoldahanipabibilanggoschoolsmangingisdanggodasahanbagospentindividualpedrointoataquesmaramitataasmejoincreasedabsdigitalisinulatvivanagliliyabnakakapamasyalnagliliwanagtatayomagdoorbellnaka-smirktig-bebentemagsugaltumawapinagawamarurumiipinauutangkastilangnakatitigsay,business:cramemagisipmatagumpaynapadaansmilenapadpadbarongmayroongilagaylalake1990napatayohilingmatanglumilingonwasteiconspresleyletterdulotdikyamiilannuonwestmagpuntaestargreatsignificantdividesresearchrestawanbasahanpayonagkwentoprogrammingdoingcreatingneverpacenag-pouttobaccokarununganlagimatagpuannagcurvemagkakaroonpaanocultivationaga-aganagsinehumihinginapawiinlovedamdaminkakayananniyanbantulothinampasbinataknagsisigawquarantinegowncandidatesalletiyakbalatkultursonidomayabangmalikotaaisshnagtawananpinatidfiaaabotpakilutobagyongprobablementecebubobopakainbathalaupangauditmapakalirichstevecallingmenuborntrainingtechnologymakapilingwaitnamumulaklakkundimantrainsnakabaonnapamuntinlupainvesting:kaninolupaloplibingtotoonagtitindanag-aalalangpinagsikapansasagutintiniradormagkaibangimporkalayuanfigurehinahanapmalulungkotnasasalinanmaisipsusunodmatayogbinibilangmakulitreaderscinekumatok