Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

18 sentences found for "desde"

1. Desde la época medieval, se han practicado diferentes géneros musicales, como el canto gregoriano y el canto mozárabe

2. El ajedrez es un pasatiempo que disfruto desde niño.

3. En resumen, la música es una parte importante de la cultura española y ha sido una forma de expresión y conexión desde tiempos ancestrales

4. Estos dispositivos permiten a las personas comunicarse desde cualquier lugar, ya que se conectan a redes de telecomunicaciones y no requieren una línea física para funcionar

5. Fue inventado en 1876 por Alexander Graham Bell y desde entonces ha evolucionado para incluir un

6. Fue inventado en 1876 por Alexander Graham Bell y desde entonces ha revolucionado la forma en que las personas se comunican

7. Hay una gran variedad de plantas en el mundo, desde árboles altos hasta pequeñas flores.

8. La agricultura es una carrera honorable y vital que ha existido desde tiempos antiguos.

9. La música es una forma de arte universal que se ha practicado en todas las culturas desde tiempos ancestrales

10. La pintura es una forma de expresión artística que ha existido desde tiempos antiguos.

11. La vista desde la cima de la montaña es simplemente sublime.

12. Las aplicaciones móviles permiten el acceso a internet desde cualquier lugar.

13. Las escuelas ofrecen programas educativos desde preescolar hasta la universidad.

14. Las hierbas medicinales se utilizan desde hace siglos para tratar diversas dolencias.

15. Las plantas anuales completan su ciclo de vida en un solo año, desde la germinación hasta la producción de semillas.

16. Los amigos que tenemos desde la infancia suelen ser los más cercanos y leales.

17. Los padres experimentan un profundo vínculo emocional con su bebé desde el momento del nacimiento.

18. Los padres sienten un inmenso amor y conexión instantánea con su bebé desde el momento del nacimiento.

Random Sentences

1. Nagreport sa klase ang mga grupo nang limahan.

2. Grabe ang lamig pala sa South Korea.

3. Palibhasa ay magaling sa paglutas ng mga problema dahil sa kanyang mga analytical skills.

4. It can be helpful to get feedback from beta readers or a professional editor

5. Sino-sino ang mga nagsibili ng mga libro?

6. La tos nocturna puede ser un síntoma de enfermedades respiratorias como el asma y la apnea del sueño.

7. Congress, is responsible for making laws

8. En helt kan være enhver, der hjælper andre og gør en positiv forskel.

9. Kung hindi ngayon, kailan pa?

10. Nag hiking kami sa Mt. Makiling.

11. Nakinig ang mga estudyante sa guro.

12. Tinig iyon ng kanyang ina.

13. Balita ko, maraming restawran sa Boracay.

14. They are not running a marathon this month.

15. He cooks dinner for his family.

16. Anong klaseng kuwarto ang gusto niya?

17. La lluvia produjo un aumento en el caudal del río que inundó la ciudad.

18.

19. Bilang paglilinaw, ang sinabi kong deadline ay sa Biyernes, hindi sa Sabado.

20. Kucing juga dikenal dengan kebiasaan mereka untuk mengasah kuku di tiang atau benda lainnya.

21. Nanahimik na nga lang din ako kasi nakakapagod makipagtalo.

22. Pupunta si Trina sa Baguio sa Oktubre.

23. Bawal magpapakalat ng mga fake news dahil ito ay nagdudulot ng kaguluhan at kawalan ng tiwala sa media.

24. Tuwing Chinese New Year, nagtutungo ang mga tao sa mga templo upang magbigay-pugay.

25. However, concerns have been raised about the potential impact of AI algorithms on jobs and society as a whole.

26. Bawal kang mapagod.. papagalitan nila ako pag napagod ka..

27. The telephone has also played an important role in politics, as it has made it possible for leaders to communicate quickly and easily

28. They are a member of the National Basketball Association (NBA) and play in the Western Conference's Pacific Division.

29. We finished the project on time by cutting corners, but it wasn't our best work.

30. Ang tubig-ulan ay maaaring magdulot ng kaguluhan sa mga lugar na hindi handa sa mga pagbabago sa panahon.

31. Sino-sino ang mga kaklase ni Carmen?

32. Ada juga tradisi memotong tali pusar setelah kelahiran, yang dianggap sebagai tindakan penting untuk menjaga kesehatan bayi.

33. We need to reassess the value of our acquired assets.

34. Inilagay nya sa poon ang biniling sampaguita.

35. You may now kiss the bride. Sabi nung priest.

36. They do not eat meat.

37. You reap what you sow.

38. I fell for an April Fool's joke on social media this year - a friend posted a fake news article that was so convincing I thought it was real.

39. La paciencia nos enseña a esperar el momento adecuado.

40. The acquired assets included several patents and trademarks.

41. Inflation kann die Preise von Vermögenswerten wie Immobilien und Aktien beeinflussen.

42. Oh! What a coincidence, dito ka pala nagtatrabaho?

43. Magalang na nangumusta si Ana sa kanyang mga magulang pagkatapos ng isang mahabang biyahe.

44. Lazada has faced criticism over counterfeit products being sold on its platform.

45. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

46. Sumakay kami ng kotse at nagpunta ng mall.

47. Nous avons prévu une séance photo avec nos témoins après la cérémonie.

48. Nandoon lamang pala si Maria sa library.

49. Ininom ni Henry ang kape sa kusina.

50. The Taj Mahal in India is a magnificent wonder of architecture.

Recent Searches

desdecebusamumemorialdevelopedbawalanudeclarestagebringingmainitdaddytuklassetsreturnedano-anonegativeinvolvehalakhaknaliligosimulanothingtotookasalukuyanfilipinokainnakuhanggabi-gabicentermalawakyumaoteamkumakainmatakaragatanpampagandanausalsteveinternalnagsisigawlugarpinakamalapitpinoyklasefeedbackmaaarinapilireaksiyonagaw-buhaybotongdahilanmaglaropulongpagkapasanpagkatakotganangmag-asawakapwanahintakutannawalabalatginagawa1982komedornyangastatuspinggankantomightscientificninadistansyailangtinuturodiinmasaholgelaitagtuyotkapangyarihangkinauupuantumawagfotosobservererpinagsikapanre-reviewmasasabipagpiliprodujodagatengkantadakulisapdyosalalimpinagsanglaanpagtatanimpinyalawasakennabiawanglolalikodtusongexigenteakmangendviderenasabingdalawaipatuloymadurashudyatligayabutterflysapattonynag-aalaygaanotalagasumasaliwtawananevolvedbehaviormulingdumaramipeppynag-aasikasomagnifyvivaothersmedyosmokingnasasabihanangkanmaliliitmalihisaksidentekaarawantiningnananaycelularesbumotoinantaypatuloyyoungfistsdyanmultumalonanokaugnayanparatingstatestrength4thclientestyrerfourimpactedmitigatedawmalungkotasomahigitanumanboseshulikasinagbibigayconocidostaong-bayannagkantahanmalakibakitbinabaanmakilingfremstilleeskwelahannakalimutanmalasnatinhabangyarikumukuloreguleringdebatesbayangumandapagtatanongnahihiyangbumibitiwsaritapagkalitomagkasinggandaillegalyoutube,pinagbigyankalaunanbestidanecesariopuntahan