Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

4 sentences found for "format"

1. Digital oscilloscopes convert the analog signal to a digital format for display and analysis.

2. Format your book: Once your book is finalized, it's time to format it for publication

3. Instagram has a "feed" where users can see posts from the accounts they follow, displaying images and videos in a scrolling format.

4. This can include creating a cover, designing the interior layout, and converting your manuscript into a digital format

Random Sentences

1. Bumili kami ng isang piling ng saging.

2. Pets, including dogs, can help children develop empathy and responsibility.

3.

4. I have started a new hobby.

5. Malakas ang narinig niyang tawanan.

6. Nakasuot siya ng pulang damit.

7. This is my girl, Jacky. pagpapakilala ni Maico sa akin.

8. My favorite April Fool's joke of all time was the time my cousin convinced her entire family that she had won the lottery.

9. Cooking at home with fresh ingredients is an easy way to eat more healthily.

10. Nalaman ito ni Venus at binigyan ng pagsubok sina Psyche at Cupid na nalagpasan naman nila at nagsama sila nang matiwasay.

11. Punung-puno ng bunga ang puno, ngunit sobrang asim naman ng laman.

12. The team is working together smoothly, and so far so good.

13. He has bought a new car.

14. Raja Ampat di Papua Barat adalah tempat wisata yang indah dengan banyak pulau-pulau kecil, terumbu karang, dan satwa liar.

15.

16. Sumakit ang tiyan ko kagabi kaya ako ay biglaang nagka-sick leave.

17. Lumingon ako sa kanya. Kita ang paga-alala sa mga mata niya.

18. La realidad es que nunca sabemos lo que nos depara el futuro.

19. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

20. Cosechamos los girasoles y los pusimos en un jarrón para decorar la casa.

21. Ang mga punong-kahoy ay hindi lamang maganda

22. Tuwing biyernes, ginugol niya ang buong araw sa paglilinis at paglalaba ng bahay.

23. Cheating can be caused by various factors, including boredom, lack of intimacy, or a desire for novelty or excitement.

24. Magtanim tayo ng kabutihan sa lupa upang anihin natin sa langit.

25. Ang dedikasyon ni Carlos Yulo sa kanyang isport ay nagdala sa kanya ng tagumpay sa pandaigdigang entablado.

26. Basketball can be a fun and engaging sport for players of all ages and skill levels, providing an excellent opportunity to develop physical fitness and social skills.

27. The weather is holding up, and so far so good.

28. Different types of stocks exist, including common stock, preferred stock, and penny stocks.

29. Aling hiwa ng baboy ang gusto mo?

30. At leve med en tung samvittighed kan føre til søvnløshed og andre sundhedsproblemer.

31. Natawa ako sa maraming eksena ng dula.

32. Ihahatid ako ng van sa airport.

33. Nakagagamot ng diyabetis ang halamang ito.

34. Malaya na ang ibon sa hawla.

35. Nasa gitna ng kanyang pagsasalita, napadungaw siya sa kanan at nakita ang isang bata na tumatawa.

36. I can tell you're beating around the bush because you're not looking me in the eye.

37. El ballet clásico es una danza sublime que requiere años de entrenamiento.

38. Inflation kann auch durch eine Verringerung der Produktion verursacht werden.

39. He realized too late that he had burned bridges with his former colleagues and couldn't rely on their support.

40. Ang pagpapalaganap ng mga konspirasyon at teorya ng kung ano-ano ay nagpapakita ng pagiging bulag sa katotohanan.

41. Ako po si Maico. nakangiting sabi niya.

42. Ang talento ng mga Pinoy sa pagkanta ay hinahangaan sa buong mundo.

43. It encompasses a wide range of areas, from transportation and communication to medicine and entertainment

44. It was risky to climb the mountain during a thunderstorm.

45. Det er vigtigt at have en kompetent og erfaren jordemoder eller læge til stede under fødslen.

46. The director shouted "break a leg!" as we went onstage.

47. Piece of cake

48. It is brewed from roasted coffee beans, which come from the Coffea plant.

49. Nilinis ng mga taga-Tungaw ang kanilang maruming ilog.

50. Triggering is a key feature of oscilloscopes, allowing users to stabilize and synchronize waveforms.

Similar Words

information

Recent Searches

formatwaysdamitmataraysparenakakabangondumarayopalaisipansaannaguguluhangpatutunguhanextraedadnaghanapnecesariobaogitanasculturaoperasyoniloilounanalaytignanlaryngitiselvismarsogoingjohntumambadsiempreflaviogreenwhetheryumuyukonakikihalubilomarurusingbobotonaninirahantenidonalamanrektanggulomagwawalamateryalestutungodulanalungkotnapapalibutannaramdamballisulatpollutionsesameeskuwelahanyakapinnaglahopagbebentaikukumparadispositivotungoiyamottoolsduwendelagaslasdawcalidadnapasukohigamasdaninalisawitinlearnpagtitiponanotherpootyeloisugamulighedbroadcastsamfundterminoprimerkablanpinakamatapatpagkalungkotcultivokumukuhaiikotmakasilongunahinopgaver,gulatnapapasayanag-iisacultivarpunohitamumuntingmedisinakubyertosdoble-karanakatalungkonagmadalingniyannagtungomangangahoynagsasagotpagkamanghatravelerkinagagalakkumitanakakagalingsanahuluinabutanmahinogpambatangunattendednapakahabamedikalokaymagtatanimtungkodadgangkondisyonkuryentenailigtasmagdamaganpagkakilalajeepneyjosienatitiyakgawainhonestonabuhaynatinagnagsamasiguradomahirapnavigationtemperaturanakilalaisinuotpanindatatanggapinpangilmaistorboituturopinagkasundokasoyiyakmusiciansmaalwangloloperyahanpalitannodmalawakmaranasanhawlapigilanpalantandaanmaubosandoykaragatananumanshoppingvariedadlupainalaganaiinitansoundfarmlimiteduntimelynenakabuhayantamavelstandipinasyangbingbinggagviolenceparinoutlinesumasakititinatapatwordbukodweddingcalciumnakasuotamerikatill1920sideyaprovecuentanbokmarchbilhin