Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

23 sentences found for "products"

1. Affiliate marketing: If you have a blog or social media following, you can earn money by promoting other people's products and earning a commission on any sales you generate

2. Amazon offers a wide range of products and services, including electronics, clothing, books, music, and more.

3. Amazon's Alexa virtual assistant is integrated into many of its products, including the Echo smart speaker.

4. Bawal magpakalat ng mga fake products dahil ito ay nagdudulot ng kawalan ng seguridad sa kalusugan at kaligtasan ng mga mamimili.

5. Businesses and brands utilize Instagram to promote products and services through visually appealing posts.

6. Calcium-rich foods, such as dairy products and tofu, are important for bone health.

7. Emphasis is often used in advertising and marketing to draw attention to products or services.

8. Lazada has a social commerce feature called Lazada TV, which allows customers to buy products directly from influencers and celebrities.

9. Lazada has faced criticism over counterfeit products being sold on its platform.

10. Lazada has launched a live streaming feature that allows sellers to showcase their products and interact with customers in real-time.

11. Lazada has partnered with local brands and retailers to offer exclusive products and promotions.

12. Lazada offers a fulfillment service called Fulfillment by Lazada (FBL), which allows sellers to store their products in Lazada's warehouses and have Lazada handle shipping and customer service.

13. Lazada offers a wide range of products, including electronics, fashion, beauty products, and more.

14. Musk has faced criticism over the safety of his companies' products, such as Tesla's Autopilot system.

15. Selling products: You can sell products online through your own website or through marketplaces like Amazon and Etsy

16. Smoking can be addictive due to the nicotine content in tobacco products.

17. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

18. The beauty store has a variety of skincare products, from cleansers to moisturizers.

19. The company burned bridges with its customers by providing poor service and low-quality products.

20. The company launched a series of new products, targeting different customer segments.

21. The store offers a variety of products to suit different needs and preferences.

22. The website's online store has a great selection of products at affordable prices.

23. This could be physical products that you source and ship yourself, or digital products like e-books or courses

Random Sentences

1. Il est important de savoir gérer son argent pour éviter les problèmes financiers.

2. Seguir nuestra conciencia puede ser difícil, pero nos ayuda a mantenernos fieles a nuestros valores y principios.

3. Umakyat sa entablado ang mga mang-aawit nang limahan.

4. Pero mukha naman ho akong Pilipino.

5. Masyadong maluwang ang pantalon na ito.

6. Si Chavit ay may alagang tigre.

7. May bagong aklat na inilathala ukol kay Manuel Quezon at tungkol ito sa pag-unlad ng teknolohiya.

8. Bilang paglilinaw, hindi mandatory ang pagsali sa aktibidad na ito.

9. Bumili si Ryan ng pantalon sa palengke.

10. Si Josefa ay maraming alagang pusa.

11. If you think he'll agree to your proposal, you're barking up the wrong tree.

12. Sweetness can be enjoyed in moderation as part of a balanced and healthy diet.

13. Maaga kaming nakarating sa aming pupuntahan.

14. Gaano siya kadalas uminom ng gamot?

15. Inihanda ang powerpoint presentation

16. Inihayag ng mga empleyado ang kanilang mga mungkahi upang mapabuti ang mga proseso sa opisina.

17. Yumabong ang mga negosyo na mayroong social media presence dahil sa kanilang pagkakaroon ng mas malawak na market.

18. Hindi ko masikmura ang pumatol sa walang kalaban laban.

19. Omelettes are a popular choice for those following a low-carb or high-protein diet.

20. Los héroes nos recuerdan que todos tenemos el potencial de marcar la diferencia en el mundo.

21. Siya nama'y maglalabing-anim na.

22. Kinuskos niya ang kanyang buhok at nabasa pati ang kanyang anit.

23. Gusto ko pumunta, pero pagod na ako.

24. Dialog antaragama dan kerja sama antarumat beragama menjadi penting dalam membangun perdamaian dan keharmonisan di tengah keragaman agama.

25. Nanalo siya ng sampung libong piso.

26. Disse virksomheder er ofte i førende positioner inden for deres respektive brancher, og de er med til at sikre, at Danmark har en høj grad af økonomisk vækst

27. Ang mga bayani ay nagpapakita ng malasakit at pagmamalasakit sa kapwa tao.

28. The bride and groom usually exchange vows and make promises to each other during the ceremony.

29. The TikTok community is known for its creativity and inclusivity, with users from all over the world sharing their content.

30. Bawal magpakalat ng mga paninira sa kapwa dahil ito ay labag sa moralidad at etika.

31. Ang mga anak-pawis ay nagtatrabaho sa iba't ibang sektor ng ekonomiya, tulad ng agrikultura at pagmimina.

32. Una conciencia pesada puede ser un signo de que necesitamos cambiar nuestra conducta.

33. Kaya't tama lamang na ito rin ay kanyang ipapamana sa nag-iisang anak.

34. Muntikan na syang mapahamak.

35. Baby fever can affect people of various ages, backgrounds, and genders.

36. Natutuwa siya sa husay ng kanyang naisip.

37. Gawan ninyo ng paraang makalabas po sana ako sa pagkakakulong ko sa loob ng prutas na ito.

38. Sa panahon ng digmaan, madalas na nagkakaroon ng migrasyon at pagkawala ng mga tao sa kanilang tahanan.

39. Users can like, react, or share posts on Facebook to show their engagement and support.

40. She was already feeling overwhelmed, and then she received a massive bill in the mail. That added insult to injury.

41. Lumipad ang binatang naging kulisap upang hanapin ang babaeng mas maganda pa kaysa sa engkantada.

42. Mahalaga ang pagtitiyaga sa bawat bagay na ating ginagawa, datapapwat ay may mga pagkakataon na hindi natin nakukuha ang inaasahan nating resulta.

43. Anong bago?

44. Accomplishing a long-term goal can create a sense of euphoria and relief.

45. Nagagalit ako sa mga sakim na mga minahan.

46. All these years, I have been striving to live a life of purpose and meaning.

47. Oh, eh bakit naman? tanong naman nung isa.

48. Research on viruses has led to the development of new technologies, such as CRISPR gene editing, which have the potential to revolutionize medicine and biotechnology.

49. Hindi mo alam kung maarte siya o hindi dahil hindi siya masyadong nakikihalubilo sa ibang tao.

50. Forgiveness requires a willingness to let go of the desire for revenge or retribution and choose compassion instead.

Similar Words

products:

Recent Searches

bumiliproductskuligligkuwebakalalakihantungawpagtutolmanlalakbaywaringdiretsolacsamanababadarkpublishinglangmaaringsatisfactionorasgranpoonamongmagtanghaliandrenadogawinpackagingmisteryoimpitconeachkumapitutilizannasaangpabiliinalishapdisuedemakakalimutinhealthiervelfungerendephilippinetenidokadalagahangmarurumiibinilinanlalamigitinaaslever,pinaulananmagkakasamanaabutanuncheckedomelettenakaoperahanlalakeprogrammingquicklyprogressmatabadahilmag-isamasknegosyantebalotnagpagupitmaliitkinatatakutankingdompatuloypaakyatnapilikasamangnagtawananheftytumakaspinauupahangplanning,marangalnamsandokferrerkamingkayabayaanputahetakotdarnafull-timeconsidermadridandamingmamasyalhuhpinakatuktokknowscornergayunpamanmalakipalikuranprotegidonakasandighouseholdniyakumakalansingburolattackpatongtumatanglawmakakatakascertainditodilagpaanosumalakayhvordananthonybakitumalismagagalingsupilinailmentsdeletinglifetsuperdesarrollarhelpedfallapacefacepakanta-kantangmahihirapparasearchnangyaringprutaspaglalabadanagugutomsalu-salopagkakatayobuhawipinangaralanpakiramdamtinulungannamingeranhalamanannababasaincomenakakapagtakafonopinakabatangpinapakiramdamanmabiliscoincidenceutoswonderdalawangexperience,gagambapatientbirdsturonwalamatayoginfectiousperopalagiikinakatwiranmanananggalmetromananaogsulinganngunitpaaellenkaringimaginationflexiblesequeregalotypesilingstartedkamukhakikilosearlysinisirakriskaabipayatkinabukasannatagosinabipeoplecrosspakilagayikawbinasakulaymangyayari