Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

23 sentences found for "products"

1. Affiliate marketing: If you have a blog or social media following, you can earn money by promoting other people's products and earning a commission on any sales you generate

2. Amazon offers a wide range of products and services, including electronics, clothing, books, music, and more.

3. Amazon's Alexa virtual assistant is integrated into many of its products, including the Echo smart speaker.

4. Bawal magpakalat ng mga fake products dahil ito ay nagdudulot ng kawalan ng seguridad sa kalusugan at kaligtasan ng mga mamimili.

5. Businesses and brands utilize Instagram to promote products and services through visually appealing posts.

6. Calcium-rich foods, such as dairy products and tofu, are important for bone health.

7. Emphasis is often used in advertising and marketing to draw attention to products or services.

8. Lazada has a social commerce feature called Lazada TV, which allows customers to buy products directly from influencers and celebrities.

9. Lazada has faced criticism over counterfeit products being sold on its platform.

10. Lazada has launched a live streaming feature that allows sellers to showcase their products and interact with customers in real-time.

11. Lazada has partnered with local brands and retailers to offer exclusive products and promotions.

12. Lazada offers a fulfillment service called Fulfillment by Lazada (FBL), which allows sellers to store their products in Lazada's warehouses and have Lazada handle shipping and customer service.

13. Lazada offers a wide range of products, including electronics, fashion, beauty products, and more.

14. Musk has faced criticism over the safety of his companies' products, such as Tesla's Autopilot system.

15. Selling products: You can sell products online through your own website or through marketplaces like Amazon and Etsy

16. Smoking can be addictive due to the nicotine content in tobacco products.

17. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

18. The beauty store has a variety of skincare products, from cleansers to moisturizers.

19. The company burned bridges with its customers by providing poor service and low-quality products.

20. The company launched a series of new products, targeting different customer segments.

21. The store offers a variety of products to suit different needs and preferences.

22. The website's online store has a great selection of products at affordable prices.

23. This could be physical products that you source and ship yourself, or digital products like e-books or courses

Random Sentences

1. Tingnan natin ang temperatura mo.

2. Ang mga akda ni Rizal tulad ng "Noli Me Tangere" at "El Filibusterismo" ay naglalaman ng mga kritisismo sa pamamahala ng Espanya at nag-udyok sa rebolusyonaryong diwa sa Pilipinas.

3. Natuwa ang binata sa kanya at nagwikang "Magandang umaga din sa iyo"

4. Muli niyang tiningnan ang nakabulagtang si Ogor.

5. Rutherford B. Hayes, the nineteenth president of the United States, served from 1877 to 1881 and oversaw the end of Reconstruction.

6. Inaalam pa ng mga imbestigador ang tunay na motibo ng salarin sa krimeng nagawa niya.

7. Huwag kang gagamit ng illegal na droga.

8. Ano hong klaseng sawsawan ang gusto ninyo?

9. Ang pagkakalugmok sa pag-aakala ng mga kasinungalingan ay nagpapakita ng pagiging bulag sa katotohanan.

10. Ang tag-ulan ay nagdadala ng mga pagsubok sa mga nag-aaral dahil sa pagkansela ng klase dahil sa malakas na ulan.

11. Sa hinaba-haba man daw ng prusisyon, sa simbahan din ang tuloy.

12. Smoking can cause various health problems, including lung cancer, heart disease, and respiratory issues.

13. Coping strategies such as deep breathing, meditation, or exercise can help manage feelings of frustration.

14. This has led to increased trade and commerce, as well as greater mobility for individuals

15. Ilalagay ko 'to sa mga action figure na collections ko.

16. The legislative branch, represented by the US

17. Sa panahon ngayon, mahirap makahanap ng mga taong bukas palad dahil sa kahirapan ng buhay.

18. Hindi dapat nakatutok tayo sa mga kababawan ng buhay, kundi sa kabutihan ng ating kapwa at ng ating bansa.

19. Sa mga paaralan, kadalasang nagkakaroon ng mga proyektong pagtatanim ng mga punong-kahoy upang maituro sa mga mag-aaral ang kahalagahan ng kalikasan.

20. She has written five books.

21. The patient's immune system was compromised due to their leukemia, and they were advised to take extra precautions to avoid infections.

22. Saka sila naghandang muli upang ipagtanggol ang kanilang bayan.

23. Nosotros decoramos el árbol de Navidad juntos como familia durante las vacaciones.

24. Napakahusay na doktor ni Jose Rizal.

25. Football is played with two teams of 11 players each, including one goalkeeper.

26. Omelettes are a popular choice for those following a low-carb or high-protein diet.

27. Nakita niya ang nagbabagang bulkan mula sa malayo, nagpapakita ng lakas ng kalikasan.

28. Arbejde er en vigtig del af voksenlivet.

29. Lumipat si Carlos Yulo sa Japan upang mas mapalakas ang kanyang training sa gymnastics.

30. Ang abilidad sa pangangalaga ng kalusugan ay mahalaga upang mapanatili ang malusog na pamumuhay.

31. Wag na sabi, wag kang magsayang ng gas maraming nagugutom!

32. Les écoles offrent des bourses pour aider les étudiants à payer leurs frais de scolarité.

33. Ang sundalo ay nangahas na tumayo sa gitna ng labanan upang iligtas ang isang sugatang kasama.

34. Natulak ko bigla si Maico nang may magsalita.

35. The blades of scissors are typically made of stainless steel or other durable materials.

36. Dadalawin ko ang aking mga alagang palaka sagot ng dalaga

37. Inalok niya ako ng mga kakanin na hinugot niya sa kanyang tindahan.

38. Kumain ka na ba? Tara samahan kitang kumain.

39. Me gusta escribir cartas de amor a mi pareja en el Día de San Valentín.

40. I have a craving for a piece of cake with a cup of coffee.

41. Ang umuulan nang malakas ay binulabog ang mga kalsada at nagdulot ng matinding baha.

42. "Wag kang mag-alala" iyon lang ang sagot ng dalaga sa kanya

43. A couple of friends are coming over for dinner tonight.

44. When I arrived at the book club meeting, I was pleased to see that everyone there shared my love of literary fiction. Birds of the same feather flock together indeed.

45. Ang malawak na mga taniman ng mga prutas at gulay ay nagpapakita ng isang industriya na mayabong at umuunlad.

46. Me duele al tragar. (It hurts when I swallow.)

47. Ano ang gustong orderin ni Maria?

48. Ako ang mas nagulat nang hapasin ni Maico sa hita si Mica.

49. Hindi dapat tayo gumamit ng marahas na wika sa mga pag-uusap.

50. Nakapagtataka na may ilang tao na hindi pa nakatikim ng pulotgata.

Similar Words

products:

Recent Searches

productslibongnakikitangtamaantalinonaalalanyahinognagtinginanginawaranbroadginaknowsbirthdayworldtitserpinakamaartengmalambinghanap-buhaypagka-maktolmadamingkampofeeltakboitakmataraydibisyoncebuquezonmasamangdesarrollaronpatinggayundinhagdanannangyarihalamanh-hindiguhitactionsapagkatinatupagtinutopgueststanghalimatandang-matandabasatshirtjuanitothirdpreskotigreroonkaagawuminommakisuyopag-uugalimahiwaganginutusankaniyaganakagayamagkasing-edadisipinkalawakanmaymasyadongtamanakasimangotmilyongimpitkanginaimprovekapageksamenaeroplanes-alltenidomababatidpagkagalitmanilapinag-usapankauntingmaramiescuelasfarmnagbababamagdilimpagtatanghalnanaignungnegosyodekorasyonbilltaoncommercialkarapatanlalargabinulonghayaanmalago1977datingmaghaponpollutionkamakailannakakatakotbookbalingkaysarapyungnag-aagawanpagtinginnapapatinginnagsipagtagonaroonpadalasgrowthamericanditokayaaseanlagunayourself,makapalbinabalikbagyoparehonglumahokkulungancigarettesnakabanggaprintengkantadanabitawannagliliwanagpaninginlacsamananapakalakikumustaperwisyomadalasincludevanlumuhodparusadosenangnapakalamigchinesenagreplybalitapagongkagabidatapwattesslunessignificantboholumayossupilinlumindolbuwispusob-bakitilawnagpapaigibtuwingtumutuboinadaigdigmagdaraosbinabatidietkapangyarihanlargehalamangcurrentumalisganunarkilaayanfeedbackmadungistagpiangtingingnapakaramingpalangsikatnakayukomahahabangwristmakabaliknakuhanghumiwalaynakakalayopangingimikakayurinmagkaibacomunespartepamilihang-bayanalong