Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

23 sentences found for "products"

1. Affiliate marketing: If you have a blog or social media following, you can earn money by promoting other people's products and earning a commission on any sales you generate

2. Amazon offers a wide range of products and services, including electronics, clothing, books, music, and more.

3. Amazon's Alexa virtual assistant is integrated into many of its products, including the Echo smart speaker.

4. Bawal magpakalat ng mga fake products dahil ito ay nagdudulot ng kawalan ng seguridad sa kalusugan at kaligtasan ng mga mamimili.

5. Businesses and brands utilize Instagram to promote products and services through visually appealing posts.

6. Calcium-rich foods, such as dairy products and tofu, are important for bone health.

7. Emphasis is often used in advertising and marketing to draw attention to products or services.

8. Lazada has a social commerce feature called Lazada TV, which allows customers to buy products directly from influencers and celebrities.

9. Lazada has faced criticism over counterfeit products being sold on its platform.

10. Lazada has launched a live streaming feature that allows sellers to showcase their products and interact with customers in real-time.

11. Lazada has partnered with local brands and retailers to offer exclusive products and promotions.

12. Lazada offers a fulfillment service called Fulfillment by Lazada (FBL), which allows sellers to store their products in Lazada's warehouses and have Lazada handle shipping and customer service.

13. Lazada offers a wide range of products, including electronics, fashion, beauty products, and more.

14. Musk has faced criticism over the safety of his companies' products, such as Tesla's Autopilot system.

15. Selling products: You can sell products online through your own website or through marketplaces like Amazon and Etsy

16. Smoking can be addictive due to the nicotine content in tobacco products.

17. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

18. The beauty store has a variety of skincare products, from cleansers to moisturizers.

19. The company burned bridges with its customers by providing poor service and low-quality products.

20. The company launched a series of new products, targeting different customer segments.

21. The store offers a variety of products to suit different needs and preferences.

22. The website's online store has a great selection of products at affordable prices.

23. This could be physical products that you source and ship yourself, or digital products like e-books or courses

Random Sentences

1. Sometimes I wish I could go back to a time when I didn't know so much about the world - ignorance is bliss, after all.

2. Siya ay kilala sa kanyang abilidad sa pagsusulat ng mga makabuluhang tula.

3. Puwede siyang uminom ng juice.

4. Tinawag nya kaming hampaslupa.

5. Mahal ang mga bilihin sa Singapore.

6. Pumunta si Clara sa bahay ni Maria.

7. Ang mga sumusunod na salita ang nagsasabing siya ay pulubi.

8. Isang tanod ang dumating at sinabing may dalaw si Tony

9. Have you studied for the exam?

10. The United States is a global leader in scientific research and development, including in fields such as medicine and space exploration.

11. Mange mennesker bruger påskeferien til at besøge kirkegårde og mindes deres kære.

12. Lumibot siya sa buong paligid ng ospital upang alamin ang mga pasilidad na maaaring magamit ng kanilang pasyente.

13. Hindi ko inakala na magkakaroon ako ng ganitong pakiramdam, pero crush kita.

14. Ayos ka lang ba mahal ko, bakit parang namumutla at namamayat ka? tanong ng binata.

15. Ayon sa mga ulat, may paparating umano na bagyo sa susunod na linggo.

16. Hay muchos riesgos asociados con el uso de las redes sociales, como el acoso cibernético.

17. Naglalaway siya sa bango ng kape na inilabas ng coffee shop.

18. Los niños son propensos a sufrir de tos debido a infecciones respiratorias comunes, como el resfriado común y la gripe.

19. Foreclosed properties may be sold through auctions, which can be a fast-paced and competitive environment.

20. Nakita ko ang kanyang halinghing na unti-unti nang bumibilis dahil sa takot.

21. Nagtatrabaho ako sa Manila Restaurant.

22. Les travailleurs doivent respecter les heures de travail et les échéances.

23. Bell's telephone consisted of a transmitter, which converted sound into electrical signals, and a receiver, which converted the signals back into sound

24. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

25. Naiilang pa ako sa kanya dahil bago pa lang ako sa pagliligaw, kaya hindi ko alam kung paano siya lapitan.

26. Ang pagkakalugmok sa propaganda at panlilinlang ay nagpapahiwatig ng pagiging bulag sa katotohanan.

27. Sa pagpupulong ng mga pulitiko, inilahad nila ang kanilang mga mungkahi upang maisulong ang mga batas at polisiya.

28. She has been working in the garden all day.

29. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

30. Ang kanyang kwento ay hitik sa mga magagandang detalye at makulay na karakter.

31. Natawa na lang ako, Oo nga pala, ano nga ulit tanong mo?

32. Robert Downey Jr. gained worldwide recognition for his portrayal of Iron Man in the Marvel Cinematic Universe.

33. Puwedeng gamitin ang pagguhit upang mag-drawing ng mga bagay na gusto mong ma-achieve sa buhay.

34. Mie goreng adalah mie yang digoreng dengan bumbu-bumbu khas Indonesia hingga terasa gurih dan pedas.

35. Bilang paglilinaw, hindi ako nagsabi na aalis ako, kundi lilipat lang ako ng departamento.

36. Una niyang binasa ang batok---kaylamig at kaysarap ng tubig sa kanyang batok.

37. Hindi malinis ang tubig na iyan, bumili ka ng iba.

38. His first hit, That's All Right, was released in 1954 and quickly climbed the charts

39. En mi tiempo libre, aprendo idiomas como pasatiempo y me encanta explorar nuevas culturas.

40. Binabarat niya ang mga paninda sa siyudad.

41. Sa aling bahagi ng pelikula ka natawa?

42. Inakalang hindi na darating ang bus, kaya naglakad na lamang sila.

43. Nag-umpisa ang paligsahan.

44. Kebahagiaan dapat ditemukan dalam hubungan yang sehat dan penuh cinta dengan keluarga, teman, dan pasangan.

45. Ang hinagpis ng isang ina ay dama sa kanyang bawat hikbi habang inaalala ang kanyang nawalang anak.

46. Unti-unti na siyang nanghihina.

47. Umayos ka nga! Wala ka sa bahay!

48. Cheating can occur in many forms, including physical infidelity, emotional infidelity, or both.

49. Les motivations peuvent changer au fil du temps, et il est important de s'adapter à ces changements pour rester motivé.

50. He has numerous endorsement deals and business ventures, including his own media production company, SpringHill Entertainment.

Similar Words

products:

Recent Searches

productssmallgaanomatabangchickenpoxwinginisipginaganoonadditionally,goalhousemaaritrengivebumotomanuscriptsinapaktrackkapagnaming4thchamberskarwahengpollutioninteractdarkgumagalaw-galawlumalangoynagpuntahannag-aalangannaglalatangnapakamotnakangisikahaponpanghihiyangnagnakawgulatunti-untinakatirapinakabatangpinahalatameanshuluactualidadmedicalnagkasakitmakatulognakapasalalakimasaksihannagdiretsomangkukulamdiscipliner,rebolusyonnageespadahanmagagamitmabatongtemperaturacoughingmanirahanhanapbuhayupuangymisinumpapagdamimangingisdangna-curiouspinabulaannewsalagangginawangnalalabipwestopinangaralannagdalagawainkulturbuwayajagiyanewspapersipagmalaakimarangalpasahepesosmetodiskbiglaantondotibokinventionsirasarakumatokiniibigherramientalangitnasanhikingnilulonharingsinampalelenakalabawnakatitigdeletingbintanapasyalanpublishing,affiliatemagkasinggandacapablenakapuntanilayuansystems-diesel-runattractivesanaysumasambafuryailmentsnunomesangcongresstelangsinagotjeromeyanroseflexibleorasbadinginspirationstylesagilityjunioinilingcrossdingginbreakpracticadoimagingreturnededit:puntanakakagalingmaongfundrisemakipag-barkadaeksperimenteringnakatagoopgaver,himihiyawkuwadernoninamagpahabaumigtaddrawingdelebukodterminorosariorumaragasangopisinakampanainaabottilatawananthroatdumilimoffentligehalatangmangesalathalakhaksalawerepostercontinueagricultoresmakalipasinirapannakaririmarimwinscultureutak-biyasinasadyastrategiesbumibiliinspiredpumitasabut-abotnecesarioaguagiyeramarasiganincrediblepinangalanangnag-emailpagiisipsanggolsuriinkapwa