Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

100 sentences found for "they"

1. "Dogs are better than human beings because they know but do not tell."

2. "Dogs are not our whole life, but they make our lives whole."

3. Ailments can be acute or chronic, meaning they may last for a short period of time or a long period of time.

4. As AI algorithms continue to develop, they have the potential to revolutionize many aspects of society and impact the way we live and work.

5. As the eggs cook, they are gently folded and flipped to create a folded or rolled shape.

6. Don't count your chickens before they hatch

7. Don't waste your money on that souvenir, they're a dime a dozen in the market.

8. Electric cars are environmentally friendly as they emit no tailpipe pollutants and produce zero greenhouse gas emissions.

9. Electric cars have lower maintenance costs as they have fewer moving parts than gasoline-powered cars.

10. For doing their workday in and day out the machines need a constant supply of energy without which they would come to a halt

11. Have they finished the renovation of the house?

12. Have they fixed the issue with the software?

13. Have they made a decision yet?

14. Have they visited Paris before?

15. I have an important interview today, so wish me luck - or, as they say in the theater, "break a leg."

16. I know they're offering free samples, but there's no such thing as a free lunch.

17. Instagram has a "feed" where users can see posts from the accounts they follow, displaying images and videos in a scrolling format.

18. It is important for individuals experiencing baby fever to communicate their feelings openly with their partner, family, or friends, as they can provide support and understanding.

19. It's hard to enjoy a horror movie once you've learned how they make the special effects - ignorance is bliss when it comes to movie magic.

20. John and Tom are both avid cyclists, so it's no surprise that they've become close friends - birds of the same feather flock together!

21. Just because someone looks young, it doesn't mean they're not experienced - you can't judge a book by its cover.

22. Limitations can be challenging, but they can also inspire creativity and innovation.

23. Limitations can be perceived as weaknesses, but they can also be strengths and opportunities for growth.

24. Limitations can be perceived or real, and they can vary from person to person.

25. Make use of writing software and tools, they can help you to organize your thoughts and improve your writing

26. Many people think they can write a book, but good writers are not a dime a dozen.

27. Microscopes can be used to study living organisms in real-time, allowing researchers to observe biological processes as they occur.

28. Mobile phones, also known as cell phones, are portable devices that allow people to make and receive calls anywhere they have a wireless connection

29. My friend was better off not knowing about her boyfriend's infidelity - ignorance is bliss, or so they say.

30. Patients may be discharged from the hospital once their condition has improved, or they may need to be transferred to another healthcare facility for further treatment.

31. Peter Pan takes children on an adventure to Neverland, where they never grow up and encounter pirates and fairies.

32. The company might be offering free services, but there's no such thing as a free lunch - they're probably making money another way.

33. The dedication of parents is evident in the love and care they provide for their children.

34. The internet is full of fashion blogs. They're a dime a dozen.

35. The Lakers have had periods of dominance, including the "Showtime" era in the 1980s, when they were known for their fast-paced and entertaining style of play.

36. The patient's immune system was compromised due to their leukemia, and they were advised to take extra precautions to avoid infections.

37. The seminar might be free, but there's no such thing as a free lunch - they'll probably try to sell you something at the end.

38. The team's colors are purple and gold, and they play their home games at the Staples Center.

39. The Wizard of Oz follows Dorothy and her friends—a scarecrow, tin man, and lion—as they seek the wizard's help to find their true desires.

40. There are so many coffee shops in this city, they're a dime a dozen.

41. These jobs may not pay a lot, but they can be a good way to make some extra cash in your spare time

42. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

43. They act as a bridge between their constituents and the government, conveying concerns and advocating for necessary reforms.

44. They admire the way their boss manages the company with fairness and efficiency.

45. They admired the beautiful sunset from the beach.

46. They analyzed web traffic patterns to improve the site's user experience.

47. They are a great way to use up leftover ingredients and reduce food waste.

48. They are a member of the National Basketball Association (NBA) and play in the Western Conference's Pacific Division.

49. They are attending a meeting.

50. They are building a sandcastle on the beach.

51. They are cleaning their house.

52. They are cooking together in the kitchen.

53. They are hiking in the mountains.

54. They are not attending the meeting this afternoon.

55. They are not building a sandcastle on the beach this summer.

56. They are not cleaning their house this week.

57. They are not considered living organisms because they require a host cell to reproduce.

58. They are not cooking together tonight.

59. They are not hiking in the mountains today.

60. They are not running a marathon this month.

61. They are not shopping at the mall right now.

62. They are not singing a song.

63. They are often served with a side of toast, hash browns, or fresh greens.

64. They are running a marathon.

65. They are shopping at the mall.

66. They are singing a song together.

67. They clean the house on weekends.

68. They do not eat meat.

69. They do not forget to turn off the lights.

70. They do not ignore their responsibilities.

71. They do not litter in public places.

72. They do not skip their breakfast.

73. They do yoga in the park.

74. They engage in debates and discussions to advocate for their constituents' interests and advance their agendas.

75. They go to the gym every evening.

76. They go to the library to borrow books.

77. They go to the movie theater on weekends.

78. They have adopted a dog.

79. They have already finished their dinner.

80. They have been cleaning up the beach for a day.

81. They have been creating art together for hours.

82. They have been dancing for hours.

83. They have been friends since childhood.

84. They have been playing board games all evening.

85. They have been playing tennis since morning.

86. They have been renovating their house for months.

87. They have been running a marathon for five hours.

88. They have been studying for their exams for a week.

89. They have been studying math for months.

90. They have been studying science for months.

91. They have been volunteering at the shelter for a month.

92. They have been watching a movie for two hours.

93. They have bought a new house.

94. They have donated to charity.

95. They have lived in this city for five years.

96. They have organized a charity event.

97. They have planted a vegetable garden.

98. They have renovated their kitchen.

99. They have seen the Northern Lights.

100. They have sold their house.

Random Sentences

1. Sa aming mga tagumpay, nagbabahagi kami ng kaligayahan bilang magkabilang kabiyak.

2. Snow White is a story about a princess who takes refuge in a cottage with seven dwarfs after her stepmother tries to harm her.

3. She has excellent credit and is eligible for a low-interest loan.

4. Sasagot na sana ulit ako nang lumabas ng CR si Maico.

5. Ang maaamong hayop ay nagiging mailap dahil sa pananakit ni Kiko.

6. Napuyat ako kakapanood ng netflix.

7. If you keep beating around the bush, we'll never get anywhere.

8. Sweetness can be enhanced with spices, such as cinnamon and nutmeg.

9. El parto natural implica dar a luz a través del canal vaginal, mientras que la cesárea es una operación quirúrgica que implica hacer una incisión en el abdomen de la madre.

10. Nagmadali akong pumasok sa kalsada nang abutin ko ang dakong huli ng bus.

11. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

12. Ang poot ay isang emosyon na dapat kong matutunan na kontrolin at harapin nang maayos.

13. Handa ko pong gawin ang lahat para lang tuparin Mo po ang aking kahilingan.

14. Sumaya ang mundo ni kuya dahil sa iyo.

15. I have lost my phone again.

16. Kobe Bryant was known for his incredible scoring ability and fierce competitiveness.

17. Les jeux peuvent avoir des règles et des limitations pour protéger les joueurs et prévenir la fraude.

18. Some people enjoy adding cream, sugar, or other flavorings to their coffee to enhance its taste.

19. If you don't want me to spill the beans, you'd better tell me the truth.

20. Some limitations can be temporary, while others may be permanent.

21. Uh huh? medyo naguguluhan kong sabi.

22. El proyecto produjo resultados exitosos gracias al esfuerzo del equipo.

23. Ibinigay ko ang lahat ng aking lakas at determinasyon upang makamit ang aking mga layunin.

24. Nakatayo ito sa kanyang tabi at hawak na naman ang kanyang kuwaderno at lapis.

25. Los padres pueden elegir tener un parto en casa o en un hospital, dependiendo de sus preferencias y necesidades.

26.

27. Ano ho ang gusto niyang orderin?

28. Ang tunay na pag-ibig sa bayan, ay sa sariling wika nagsisimula.

29. Si Emilio Aguinaldo ang unang pangulo ng Republika ng Pilipinas.

30. Ayaw mo pa ba? tanong niya na nagpakunot sa noo ko.

31. Kebahagiaan tidak selalu tergantung pada materi atau kekayaan, tetapi pada keadaan batin dan kepuasan diri.

32. Nang biglaang magdidilim ang paligid, nahirapan akong makita ang daan pauwi.

33. Nagwo-work siya sa Quezon City.

34. The musician released a series of singles, leading up to the release of her album.

35. Ang mga pamilya ay nag-aayos ng mga handa at nagdadasal para sa kasaganaan sa darating na taon.

36. Ano ang yari ng sahig ng bahay mo?

37. El nacimiento de un bebé puede tener un gran impacto en la vida de los padres y la familia, y puede requerir ajustes en la rutina diaria y las responsabilidades.

38. Ipinakita ng dokumentaryo ang mga kaso ng abuso sa mga nakakulong na bilanggo.

39. Sayang, aku sedang sibuk sekarang. (Darling, I'm busy right now.)

40. Trapik kaya naglakad na lang kami.

41. May bagong batas na ipinatupad ukol sa proteksyon ng mga manggagawa.

42. Kuripot daw ang mga intsik.

43. Kumaripas ng uwi si Pedro matapos niyang marinig ang masamang balita.

44. Hindi dapat sumuko agad kapag mailap ang posibilidad ng tagumpay.

45. Sumali ako sa Filipino Students Association.

46. Anong klaseng adobo ang paborito mo?

47. Naniniwala ang ilang tao na ang albularyo ay may kakayahang mag-alis ng masamang espiritu.

48. Håbet om at opnå noget kan give os styrke og energi.

49. Hindi mapigilan ang panaghoy ng binata nang mabasa ang liham ng kanyang mahal.

50. Ang aking kabiyak ay palaging nasa tabi ko sa hirap at ginhawa.

Recent Searches

labingtheydatapwatoutlinesgranfakepagsasalitapagbabagong-anyocompletingnamumuongpagkakayakapbarung-barongnanghahapdimoviesnagpapaniwalamagkikitanagbabakasyonbiologinagpuyosiwinasiwassikre,labing-siyamnapapatungokapangyarihangnalalabiikawtawanangangakoincluirvideoshanapbuhaypamilyakayabanganumuwitotoongcardigankapitbahaynakakaanimnapakabilisestasyonmamahalinnakahainibinigayinterests,bumabalotteachingskanilasumasakayjolibeeakmangkanayangmakisuyoisinaranabigaypatuloyalagangmagselosbahagyasilid-aralanbakantenabuhaykaratulangpaulit-ulitkapintasangnaglaonentertainmenttayomatulunginbanlagexperience,ahhhhkatolikoasawanakasakaypamimilhingasiatickatagalanherramientahigh-definitionabanganmarangyangkamustainakyatjuanreviewfiverrlalongmadalingpamamahingahagdanfe-facebooktinapayhastadogssikoayokobusykasopriestiyanconsumelumulusobmasinopinagawnamnaminsusunodalexandermakaratingsuccessmininimizenagdarasalkasingtigashmmmmaniyahdtvfauxmadamisubalitpitobinawiprinceproductionduonpaskohousesanghojas,nilalangstrengthcommissionlargerzoompostcardscientificpakelambuwansaanfeedback,bosscomienzanpinag-usapaninterpretinglastingcomunessutiltwinklesedentaryeveningdendincontrolledwindowcuandostringflashshouldvanviewimprovedinternapaghahanguannag-googlematiyakmetodisktiningnanaddictionpapuntangnagtatakbodogcebunaririnignakaririmarimpagkakatayohighestjosepatutunguhancafeterialockdownsinundanglatekampeonramdamkaklasepicturesbagokapekailanpaguutosmarkedkasamaangbasketbolkisapmatakahusayanpakukuluaniiwasanevolucionadomagkanopaliparinanitaong