Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

10 sentences found for "efforts"

1. Cancer awareness campaigns and advocacy efforts aim to raise awareness, promote early detection, and support cancer patients and their families.

2. Conservation efforts, such as protecting natural habitats and endangered species, are critical to maintaining a healthy environment.

3. In the last three hundred years, many human efforts have been spent in search of sources of energy-coal, petroleum, and power generated from water which will maintain the present rhythm of civilization unchecked

4. Lazada has a strong focus on customer service and has won awards for its efforts.

5. Musk's companies have been recognized for their innovation and sustainability efforts.

6. Smoking is a global public health issue that requires ongoing efforts to prevent and reduce smoking prevalence.

7. The community admires the volunteer efforts of local organizations.

8. The dedication of healthcare professionals is evident in their tireless efforts to provide care and save lives.

9. The foundation's charitable efforts have improved the lives of many underprivileged children.

10. Trump implemented various policies during his tenure, including tax cuts, deregulation efforts, and immigration reforms.

Random Sentences

1. Electric cars can be charged using various methods, including home charging stations, public charging stations, and fast charging stations.

2. Ikinagagalak kong makilala ka sa personal pagkatapos ng maraming taon ng pagkakaibigan online.

3. Ang mahal na ng presyo ng gasolina.

4. Nakakapagpatibay ng buto ang calcium.

5. His invention was an improvement over earlier attempts to create a long-distance communication device, such as the telegraph, which could only transmit messages in Morse code

6. Il est également important de célébrer les petites victoires en cours de route pour rester motivé.

7. Sumapit ang isang matinding tagtuyot sa lugar.

8. Nagtatanim ako ng mga gulay sa aking maliit na taniman.

9. Ang masakit na alaala ay patuloy na nagpapalala sa kanyang hinagpis.

10. Ang pagpapahalaga at pag-unawa ng aking mga magulang sa aking sitwasyon ay nagpawi ng aking lungkot at kalungkutan.

11. Kailan itinatag ang unibersidad mo?

12. I have been working on this project for a week.

13. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

14. Nationalism can also lead to a sense of resentment and hostility towards outsiders.

15. Human activities, such as pollution and deforestation, have a significant impact on the environment.

16. Ikinasasabik ni Armael ang pagpunta sa kasal.

17. Nanonood nga muna ito at saka lang bumaba sa nananalong grupo.

18. La obra de Leonardo da Vinci es considerada una de las más importantes del Renacimiento.

19. Marahil ay hindi pa sapat ang oras na nakalaan para matapos ang proyekto.

20. Sa tahanan, ako'y nakatulog nang matiwasay sa aking malambot na kama.

21. Nagsusulat ako ng mga pangungusap sa papel upang ma-praktis ang aking bokabularyo.

22. Microscopes are important tools for medical diagnosis and treatment, allowing doctors to examine cells and tissues for abnormalities.

23.

24. Likas na mabait si Perla pasensiya na lamang ang kaniyang binibigay sa kapatid na si Amparo na ubod na tamad.

25. The store offers a store credit for returns instead of a cash refund.

26. Limitations can be cultural or societal, such as gender roles or stereotypes.

27. Tumulo ang laway niya nang nakita niya ang pinaka-masarap na kakanin na inihain sa kanya.

28. For you never shut your eye

29. Ang tubig-ulan ay maaaring gamitin sa pagsasaka at iba pang mga pangangailangan ng mga tao.

30. Sa mga nakalipas na taon, yumabong ang mga organisasyon na tumutulong sa mga nangangailangan.

31. With dedication, patience, and perseverance, you can turn your manuscript into a finished book that you can be proud of

32. Tumawag ako kaninang umaga pero wala ka.

33. Eto isuot mo. binigay ko sa kanya yung dress na binili ko.

34. They may draft and introduce bills or resolutions to address specific concerns or promote change.

35. Limitations can be physical, mental, emotional, financial, or social.

36. Sa paligid ng aming bahay, naglipana ang mga bulaklak sa halamanan.

37. Mas maliit ang bag ko sa bag ni Cassandra.

38. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

39. Aba oo, yun lang pala, nakakunot-noong sagot ni Kablan.

40. Ikinagagalak kong maglingkod sa inyo bilang inyong guro.

41. Hinabol kami ng aso kanina.

42. Nagbabala ito na may darating na lindol sa kapatagan at magbibitak-bitak daw ang lupa sa kapaligiran.

43. Inflation kann auch durch eine Verringerung des Angebots an Waren und Dienstleistungen verursacht werden.

44. The backpack was so hefty, it felt like it weighed a ton.

45. Musk's SpaceX has successfully launched and landed reusable rockets, lowering the cost of space exploration.

46. The pretty lady in the movie stole the protagonist's heart.

47. Gawan ninyo ng paraang makalabas po sana ako sa pagkakakulong ko sa loob ng prutas na ito.

48. Naging biktima ng agaw-buhay na pagnanakaw ang kanyang pamilya.

49. All these years, I have been cherishing the relationships and connections that matter most to me.

50. Ang maniwala sa sabi-sabi, walang bait sa sarili.

Recent Searches

daweffortshallumiilinginterestroboticnagreplyenterlabisprovidedstoplightconnection2001downdanceviewsageartificialbukaslaylaynakakarinigpagkabatapagtatanimagaw-buhaymasayang-masayascientistpagsambakainibonsasabusinessesmongnapakaramingpapelchambersgayunpamandumibroadcaststinaasabatilabisigtamabumangonsellingmagworktactotoretetatawaganlawakendidalandanalignstaga-lupangabigaelmininimizemagpapigilmakalipasnilolokobumugangunitkatagalumayasdriverkatibayangagricultorespaaralankitangtuloy-tuloypinag-usapansanggolpagguhitmagagamitlumutangconocidoskamotecanteenindustriyagumigisingrodonamasokbukapanahonbagyopalapitnumerosaskagabibalitamamalasmakauwipinigilannakahugberetimoneyvaledictorianfreedomspinagsikapanmagta-trabahopagkakatuwaantiniradorencuestasikinatuwasimulapinakamaartenggumagalaw-galawkumakainpagkaraanapakamotpagpilihinimas-himassteerbuung-buodisenyongpostkinagagalaknaiinitandisseinspireimagestaga-ochandoginhawasandwichpinipilitkapwanewsmasakitmayamangdiliginsidokapallaganap1920smadurasmalihispasalamatanpanatagbrindarmisaigigiitpoot1980hisobstaclesadvancedatacharmingmadalingbulatefataudio-visuallydeathsinongsinikapinilingcomputereimagingbehalfnakipagtagisanpinauupahangisinagottatanggapintwobitbitallowslakadanotherenvironmenttataydadaanywherenizaddingnaritowhilebankabenaplanning,medidanakahigangsumasambaguestsnapapansintutorialsaparadorsections,kailannagdalabasahinaktibistabutterflydisciplinklasematesagreatlysaleskasuutanngisijobalasmakinang