Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

10 sentences found for "efforts"

1. Cancer awareness campaigns and advocacy efforts aim to raise awareness, promote early detection, and support cancer patients and their families.

2. Conservation efforts, such as protecting natural habitats and endangered species, are critical to maintaining a healthy environment.

3. In the last three hundred years, many human efforts have been spent in search of sources of energy-coal, petroleum, and power generated from water which will maintain the present rhythm of civilization unchecked

4. Lazada has a strong focus on customer service and has won awards for its efforts.

5. Musk's companies have been recognized for their innovation and sustainability efforts.

6. Smoking is a global public health issue that requires ongoing efforts to prevent and reduce smoking prevalence.

7. The community admires the volunteer efforts of local organizations.

8. The dedication of healthcare professionals is evident in their tireless efforts to provide care and save lives.

9. The foundation's charitable efforts have improved the lives of many underprivileged children.

10. Trump implemented various policies during his tenure, including tax cuts, deregulation efforts, and immigration reforms.

Random Sentences

1. The damage done to the environment by human activity is immeasurable.

2. Te agradezco por estar siempre ahí para mí.

3. Yumabong ang interes ng mga kabataan sa pag-aaral ng STEM (Science, Technology, Engineering, at Mathematics) na may magandang kinabukasan.

4. Forgiving ourselves is equally important; we all make mistakes, and self-forgiveness is a vital step towards personal growth and self-acceptance.

5. Sa gitna ng tagtuyot, ang mga magsasaka ay nagiigib mula sa ilog para sa kanilang mga pananim.

6. Eine klare Gewissensentscheidung kann uns helfen, unser Leben in Einklang mit unseren Überzeugungen zu leben.

7. Gusto kong namnamin ang katahimikan ng bundok.

8. Nalaki ang mga mata ni Mica sa sinabi ni Maico.

9. In conclusion, making a book is a creative and fulfilling process that requires planning, research, and hard work

10. Sa aming pagdiriwang ng buwan ng wika, nagkaroon kami ng pagtatanghal na nagpapakita ng kahalagahan ng bayanihan.

11. Buenos días amiga

12. Limitations can impact one's career, relationships, and overall quality of life.

13. Sa pagtulog, ang katawan ay nagpapalakas at nagpaparegla ng mga proseso nito.

14. Aray! Bakit mo ako sinapak! Potaena mo naman!

15. Walang tutulong sa iyo kundi ang iyong pamilya.

16. Ang haba na nang bigote mo, mag ahit ka nga!

17. Con paciencia y dedicación, se puede disfrutar de una deliciosa cosecha de maíz fresco

18. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

19. Magkano ang tiket papuntang Calamba?

20. Money can take many forms, including cash, bank deposits, and digital currencies.

21. Las heridas en las extremidades pueden requerir de vendajes compresivos para detener el sangrado.

22. The United States has a diverse landscape, with mountains, forests, deserts, and coastal regions.

23. Magdoorbell ka na.

24. Drømme kan være en kilde til kreativitet og innovation.

25. I am absolutely impressed by your talent and skills.

26. Sa takip-silim, maaaring mas mapakalma ang mga tao dahil sa kulay at hangin na mas malumanay.

27. Ako ay nagtatanim ng mga succulent plants sa aking munting terrarium.

28. There are a lot of opportunities to learn and grow in life.

29. Nagkamali ako ng bitbitin, wala akong kubyertos para sa packed lunch ko.

30. Mag o-online ako mamayang gabi.

31. Du behøver ikke at skynde dig så meget. Vi har masser af tid. (You don't need to hurry so much. We have plenty of time.)

32. Ang malawak na mga taniman ng mga prutas at gulay ay nagpapakita ng isang industriya na mayabong at umuunlad.

33. In recent years, the Lakers have regained their competitive edge, with the acquisition of star players like LeBron James and Anthony Davis.

34. "Maghintay ka lang," ani ng guro sa kanyang estudyante.

35. Tsuper na rin ang mananagot niyan.

36. Paki-charge sa credit card ko.

37. Ano ho ba ang dapat na sakyan ko?

38. Paano kayo makakakain nito ngayon?

39. Kumaripas si Mario nang mahulog ang kanyang sumbrero sa kalsada.

40. "A dog is the only thing that can mend a crack in your broken heart."

41. The political campaign gained momentum after a successful rally.

42. Ang pagkakaroon ng mapagkakatiwalaang kaibigan ay siyang ikinagagalak ni Carla.

43. Ang haba na ng buhok mo!

44. Pinaniniwalaang ang albularyo ay may kaalaman sa lihim na karunungan ng kagubatan.

45. Limitations can be perceived or real, and they can vary from person to person.

46. Uncertainty about the outcome of the election has caused tension in the community.

47. Iskedyul ni Tess, isang estudyante

48. Sa naglalatang na poot.

49. Maarte siya sa mga lugar na pupuntahan kaya hindi siya nakikipagsiksikan sa mga madaming tao.

50. Sinabi ko nang binangga ako nang pasadya, na naramdaman ko ang kanyang kamay sa aking bulsa.

Recent Searches

tig-bebentesuzettedaigdigpagkabuhayassociationeffortse-commerce,paraangmaongpetsahereanothermarketing:naglalakadrespektivejunionaglakadnasadagaandoysiradogsalagaupuanparusapumapasokdigitalkutodmabangonaglabamoodsumapitpopularizepumatolelitenglalababringmakapalagsikipfionaeleksyontongdeterioratemagsunogfertilizertayomagbigayanreservespagkatbansalalargaespadarewardingtrueflyalaalaberetina-curiousadvancedkalyesultanganyankahusayanpersistent,anywheremisusednagwalisburdenkare-karesasakyannakasusulasokre-reviewmovinghahahatatayostudentartificiallaganaprebolusyontodoisaacworkshopemailpangiltumangolupainevolvedeffektivtpirasopasosasongblazingbaldengpagsusulatcommercekaniyangcircleeffektivniyaasobaldecreatenagigingstoreluzkumidlatkasiyahangsakimadangkalakingagecornersinagawimpactstep-by-stepinlovematakawpupuntahanmoviesnageespadahanihandashopeefitnessnakasakayinsektongpoloabundantemakeshumiwalaynagmamadaliumakbaybadminamasdansong-writingyestalinokontratadomingotherapeuticstinuturodiinmagkaibiganisinulatimportanteskasuutanproductionlistahanalanganexigentekinahuhumalinganmasasayapaligsahanpinakamahabanagpakitaahasmajorvictorianenapakakatandaanhayaangmissiondyipniopportunity1950stinatanongkagayapakiramdamboteyaritransitpagkamanghaexperts,masayahinsurgerysakendiscipliner,yourself,tingminutematagumpaybuntiscompartenbileraumentarstuffednagreklamoextragigisingminahandahanmaghatinggabidamdamincallersuelotaosrequierenincreasedlinawdedicationjuegos