Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

10 sentences found for "efforts"

1. Cancer awareness campaigns and advocacy efforts aim to raise awareness, promote early detection, and support cancer patients and their families.

2. Conservation efforts, such as protecting natural habitats and endangered species, are critical to maintaining a healthy environment.

3. In the last three hundred years, many human efforts have been spent in search of sources of energy-coal, petroleum, and power generated from water which will maintain the present rhythm of civilization unchecked

4. Lazada has a strong focus on customer service and has won awards for its efforts.

5. Musk's companies have been recognized for their innovation and sustainability efforts.

6. Smoking is a global public health issue that requires ongoing efforts to prevent and reduce smoking prevalence.

7. The community admires the volunteer efforts of local organizations.

8. The dedication of healthcare professionals is evident in their tireless efforts to provide care and save lives.

9. The foundation's charitable efforts have improved the lives of many underprivileged children.

10. Trump implemented various policies during his tenure, including tax cuts, deregulation efforts, and immigration reforms.

Random Sentences

1. Bilang paglilinaw, hindi mandatory ang pagsali sa aktibidad na ito.

2. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

3. A quien madruga, Dios le ayuda. - The early bird catches the worm.

4. I'm sorry, I didn't see your name tag. May I know your name?

5. Beauty is in the eye of the beholder.

6. Masamang droga ay iwasan.

7. Elektroniske apparater kan hjælpe med at forbedre undervisning og læring i uddannelsessystemet.

8. Les travailleurs peuvent travailler dans des environnements différents, comme les bureaux ou les usines.

9. Sa anong tela gawa ang T-shirt?

10. Muntikan na syang mapahamak.

11. Ibinigay ng aking magulang ang kanilang buong suporta sa aking mga pangarap.

12. Sa dakong huli, mas pinili ko pa rin ang magsinungaling kaysa sabihin ang totoo.

13. Dalam Islam, doa yang dilakukan secara berjamaah dapat meningkatkan kebersamaan dan kekuatan jamaah.

14. The widespread use of mobile phones has led to an increase in distracted driving and other safety hazards

15. At forfølge vores drømme kan kræve mod og beslutsomhed.

16. Inflation kann auch durch eine Verringerung der öffentlichen Investitionen verurs

17. Ang arte. bulong ko sa may batok niya.

18. Ikaw ang dumukot ng pitaka ko, ano? Huwag kang magkakaila!

19. The scientific study of astronomy has led to new insights into the origins and evolution of the universe.

20. No me gusta el picante, ¿tienes algo más suave?

21. Puwede ka ring magguhit ng mga larawan ng kalikasan upang magpakita ng pagmamahal sa ating planeta.

22. They have been studying for their exams for a week.

23. Leonardo da Vinci nació en Italia en el año 1452.

24. Ang taong hindi marunong lumingon sa pinanggalingan ay hindi makakarating sa paroroonan.

25. Ang malalakas na tama ng kidlat ay binulabog ang langit at nagdulot ng takot sa mga tao.

26. Los powerbanks vienen en diferentes capacidades, que determinan cuántas cargas pueden proporcionar.

27. Kung walang tiyaga, walang nilaga.

28. Ingatan mo ang cellphone na yan.

29. Ayaw niya ng maarte at mataas na presyo kaya lagi siyang nagbabakasakali sa mga mababang halaga.

30. Hoy bakit, bakit dyan ka matutulog?

31. Come on, spill the beans! What did you find out?

32. Dwyane Wade was a key player in the Miami Heat's championship runs and known for his clutch performances.

33. Maliit ang telebisyon ng ate ko.

34. Money has value because people trust that it can be used to purchase goods and services.

35. Karaniwan sa kasal, mayroong seremonya ng pamamahagi ng singsing at pagbibigay ng halik sa asawa.

36. Las pinturas abstractas pueden ser interpretadas de diferentes maneras por el espectador.

37. Kung hei fat choi!

38. The existence of God has been a subject of debate among philosophers, theologians, and scientists for centuries.

39. Ang mga natatanging kontribusyon ng mga siyentipiko sa kanilang larangan ay dapat na itinuring at ipinagmamalaki.

40. La moda de usar ropa estrafalaria está llamando la atención de los jóvenes.

41. Los padres experimentan un profundo vínculo emocional con su bebé desde el momento del nacimiento.

42. En invierno, los árboles pierden sus hojas y se vuelven caducos.

43. "The more people I meet, the more I love my dog."

44. Palagi sya nagbibigay ng pagkain sa pulubi.

45. Sabi ko bumangon ka jan! Hoy!

46. Cada nacimiento trae consigo la promesa de un futuro lleno de posibilidades.

47. Lebih baik mencegah daripada mengobati.

48. Ang panitikan ay nagpapahayag ng mga damdamin at karanasan ng mga tao, at ito ay isang paraan ng pag-awit ng kanilang mga kuwento.

49. Kailangan nating magkaroon ng lakas ng loob upang tuparin ang ating mga pangarap.

50. Sweetness is an important factor in the culinary arts and food industry.

Recent Searches

dettereserveseffortsleo1876judicialmisabuwantradisyonnanginginigresponsibledulaabspossibleoneemphasisfascinatingobstaclesimaginggeneratelayuninagesagotsubalitcleancrosshatingplandancebeginningnaggingmichaelorderledbringhumanapbabadoonkampeonnamandahilwouldmuchflyevilthoughtsthemcreationgraduallystoplighteasyseenchecksuminomdebatesdisposalsambitconsiderworkingtabaevolvedleftumarawrelevantfoursakainvolvestreamingcasesrecentmulighedermagkakagustofitnessnyanagsilabasannakakulongnapaplastikannagulatmagbabagsiknamamanghainsektonggatheringilanbumubulapaulakalaunannewsneasocietyanimotumindigsuspinagmamasdancompletingnaibibigaypamburanakabuklatpaga-alalaawittumangosmokingpanatilihinhumiwalayabundantebumagsakbibilimatangumpayniyangrebolusyonanitagalogayokoshopeemapaikotiginawadahhhhrestawranhumalakhaknagpaalamnuevapabulongsiopaokaraokeincitamenterpinisilnagbabalamapangasawaself-defensekaarawaniyananaybaoisipcigaretteyamanparibranchngunitsocialesprovidedkitidea:dedicationyeahnakapilangpagpanhiknakaraangbefolkningen,gulatnagawangmagdidiskopagkagustonagmadalingnaguguluhangnakasilongnabalitaannakaka-intamadnakakasamanagtagisannakapangasawagabi-gabisaranggolanakagalawnakakatulongtogethernakakagaladapit-haponnakalipaskawawangmanggagalingkarwahengtobaccopanghabambuhaymeriendafysik,aregladobibisitagonesequepagkapasannanaoggitarasinundangfremstillemagsusuotmatalomagkamaliikinasuklamincreasinglytaxijanmakidalonagtatakapangarapmamasyalmagta-trabahonagpapaniwalanagbanggaanmagsasalita