Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

10 sentences found for "efforts"

1. Cancer awareness campaigns and advocacy efforts aim to raise awareness, promote early detection, and support cancer patients and their families.

2. Conservation efforts, such as protecting natural habitats and endangered species, are critical to maintaining a healthy environment.

3. In the last three hundred years, many human efforts have been spent in search of sources of energy-coal, petroleum, and power generated from water which will maintain the present rhythm of civilization unchecked

4. Lazada has a strong focus on customer service and has won awards for its efforts.

5. Musk's companies have been recognized for their innovation and sustainability efforts.

6. Smoking is a global public health issue that requires ongoing efforts to prevent and reduce smoking prevalence.

7. The community admires the volunteer efforts of local organizations.

8. The dedication of healthcare professionals is evident in their tireless efforts to provide care and save lives.

9. The foundation's charitable efforts have improved the lives of many underprivileged children.

10. Trump implemented various policies during his tenure, including tax cuts, deregulation efforts, and immigration reforms.

Random Sentences

1. Las plantas nativas son especies que se encuentran de forma natural en un determinado lugar y son importantes para la conservación de la biodiversidad.

2. La lluvia produjo un aumento en el caudal del río que inundó la ciudad.

3. Hindi makapaniwala ang lahat.

4.

5. La diversificación de cultivos ayuda a reducir el ries

6. Sometimes I wish I could unlearn certain things and go back to a time when I was blissfully ignorant of the world's problems - ignorance truly is bliss in some cases.

7. Magkaiba ang disenyo ng sapatos

8. Tweets are limited to 280 characters, promoting concise and direct communication.

9. Representatives are individuals chosen or elected to act on behalf of a larger group or constituency.

10. Magkikita kami bukas ng tanghali.

11. Tumayo na sya, Ok! I'll be going now, see you tomorrow!

12. Ang tubig-ulan ay nakakatulong sa pagpapanatili ng balanse ng mga ekosistema.

13. Marami akong agam-agam sa aking mga plano dahil sa mga hindi nakasiguraduhan sa buhay.

14. Hindi. Ipinangangak ako sa Cebu.

15. The executive branch, represented by the President of the United States, is responsible for enforcing laws

16. Sa mga taludtod ng kundiman, nararamdaman ang saya at lungkot na dulot ng pag-ibig.

17. Les mathématiques sont une discipline essentielle pour la science.

18. At spille ansvarligt og kontrollere ens spillevaner er afgørende for at undgå alvorlige konsekvenser.

19. Le travail est une partie importante de la vie adulte.

20. May masakit ba sayo?? Ok ka lang ba?

21. Sa takip-silim, nakakapagbigay ng magandang silip sa mga bituin at buwan.

22. The invention of the telephone can be traced back to Alexander Graham Bell, who is credited with patenting the first practical telephone in 1876

23. Ang buhawi ay maaaring magdulot ng matinding pagkasira sa kagubatan at kapaligiran dahil sa malakas na hangin at pag-ulan.

24. Pangarap ko ang makasakay sa eroplano.

25. Owning a pet can provide a sense of purpose and joy to people of all ages.

26. Dapat niyo akong pagsilbihan dahil dito.

27. Sweetness can be a source of comfort and pleasure for many people.

28. Pnilit niyang supilin ang hangaring makasilong.

29. Hindi siya sumagot sa tanong ko, waring may iniisip siyang iba.

30.

31. Samakatwid, walang makapagsabi kung saan nakatago ang gong.

32. Aku rindu padamu. - I miss you.

33. Walang mangyayari satin kung hindi tayo kikilos.

34. An oscilloscope is a measuring instrument used to visualize and analyze electrical waveforms.

35. Hindi siya nakapagpahinga ng maayos kagabi, samakatuwid, inaantok siya ngayon sa klase.

36. Maria, si Ginang Cruz. Guro ko siya.

37. Members of the US

38. Les salaires varient considérablement en fonction des métiers et des secteurs d'activité.

39. Las redes sociales permiten a las personas conectarse y compartir información con amigos y familiares.

40. Ang pagdidilim ng kalangitan ay nagpakalma sa init ng araw at nagbigay daan sa isang magandang sunset.

41. The United States has a two-party system, with the Democratic Party and the Republican Party being the two major parties

42. Stephen Curry revolutionized the game with his exceptional three-point shooting ability.

43. Ang paggamit ng mga apps at gadgets bago matulog ay maaaring makaapekto sa kalidad ng tulog ng isang tao.

44. Digital oscilloscopes convert the analog signal to a digital format for display and analysis.

45. The Tesla Roadster, introduced in 2008, was the first electric sports car produced by the company.

46. I am not planning my vacation currently.

47. Omelettes are a popular choice for those following a low-carb or high-protein diet.

48. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

49. Børns mentale sundhed er lige så vigtig som deres fysiske sundhed.

50. Kung anu ano ang kanilang pinag-usapan hanggang sa bigla na lang napabalikwas ang prinsipe na tila ba may tumawag sa kanya.

Recent Searches

effortsgreatbagyoallowingdettemahahabadiettuwinglamanpiecessinapakupoeffektivarbejderamerikalacksumalibeinteproblemalabasgodcallerkalanguestssinongdogisugamightmasdanoverallpinalutotanghalimasikmuraumuusigpaggawaboymind:breaktompreviouslyhayopnothingdaratinghalagaincreasinglysinceeyevissedentarydaangyoungminuteemailsakalingstartedvisualneedstipberkeleyjunjunsalapiawaremitigatejohnanimoffentligstoplightgoingipapahingaechavepagtangisnakaraankailanmanbaoaabotgasmenrelotaosnangalaglagdalaganagwagiyumaobinigyangamparogiraypakelampulanuhnakakarinignatinsantonakitulogkasingtigasfeelingnapakodalawsinunggabanbinigyanaidresearcheveningmakapaghilamostengaagostobathalaalexanderorugainspiredfakebertoreservationworryballlateetofredtransmitskaniyareadingcablepumayagnai-dialpaglingaumiimikaga-agaskirttabingengkantadangkontratakongresopumilimarurumiexistsequeautomaticprogrammingcompletegitaraformatevenregularmenteanotherpilingspreadmaibamaawaingtindahanumiwasumupomatutulognagtapossiopaomatagumpaydecreaseddiferentesnakapamintanamakikitanagsusulatmakapaibabawpaga-alalatinaasanpulang-pulakasangkapanressourcernemang-aawitnakaluhodkonsentrasyonkadalagahangmagtatagalnakapagreklamohumahangosmakatarunganghinawakantuluyannagkapilatmaihaharapnagpaalammagpaliwanagkikitanapaluhakapangyarihangnalakimahiyadiwatahiwahahatolnagkalapitnovellesnamataykahariannag-poutpagkagustokainitanpahabolnaiiritangpaligsahannaliligonasaanmagtatakanatatakot