Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

21 sentences found for "ailments"

1. Ailments are a common human experience, and it is important to prioritize health and seek medical attention when necessary.

2. Ailments are physical or mental health conditions that cause discomfort or illness.

3. Ailments can be a result of aging, and many older adults experience age-related ailments, such as arthritis or hearing loss.

4. Ailments can be a result of lifestyle choices, such as smoking or excessive alcohol consumption.

5. Ailments can be a source of inspiration for medical research and innovation to develop new treatments and cures.

6. Ailments can be a source of stress and emotional distress for individuals and their families.

7. Ailments can be acute or chronic, meaning they may last for a short period of time or a long period of time.

8. Ailments can be caused by various factors, such as genetics, environmental factors, lifestyle choices, and infections.

9. Ailments can be diagnosed through medical tests and evaluations, such as blood tests or imaging scans.

10. Ailments can be managed through self-care practices, such as meditation or physical therapy.

11. Ailments can be prevented through healthy habits, such as exercise, a balanced diet, and regular medical check-ups.

12. Ailments can be treated through medication, therapy, surgery, or other medical interventions.

13. Ailments can have an economic impact on individuals and society, including healthcare costs and lost productivity.

14. Ailments can have physical symptoms, such as pain, fatigue, or fever, as well as psychological symptoms, such as anxiety or depression.

15. Ailments can impact different organs and systems in the body, such as the respiratory system or cardiovascular system.

16. Ailments can impact different populations disproportionately, such as people of color, women, and those with low socioeconomic status.

17. Ailments can impact one's daily life, including their ability to work, socialize, and engage in activities.

18. Ailments can range from minor issues like a headache to serious conditions like cancer.

19. But recently it has been detected that the habit of smoking causes different kinds of serious physical ailments, beginning with coughing, sore throat, laryngitis, and asthma, and ending with such a fatal disease as cancer

20. Some ailments are contagious and can spread from person to person, such as the flu or COVID-19.

21. Some ailments are preventable through vaccinations, such as measles or polio.

Random Sentences

1. La lluvia produjo un aumento en el caudal del río que inundó la ciudad.

2. Bumili ako ng sapatos sa Shopee.

3. Twitter has implemented features like live video streaming, Twitter Spaces (audio chat rooms), and fleets (disappearing tweets).

4. Ang mga mangingisda ay nagtatanim ng mga alon sa kanilang pagmamahal sa karagatan.

5. Siya ay nangahas na mag-apply sa isang prestihiyosong unibersidad kahit mababa ang kanyang kumpiyansa.

6.

7. Ang kundiman ay nagpapaalala sa atin ng mga halaga ng pagmamahalan at pagka-makabayan.

8. Sa paglutas ng mga palaisipan, mahalaga ang pag-iisip nang malikhain at pagpapakita ng kahusayan sa loob ng isang patlang.

9. La tos productiva es una tos que produce esputo o flema.

10. Kanser ang ikinamatay ng asawa niya.

11. Ano?! Diet?! Pero tatlong plato na yan ah.

12. Kanino humingi ng tulong ang mga tao?

13. Bakit? Dahil ba mahahawa ako sa sakit mo? concern ba sya?

14. Mahusay na mahusay kumita ng pera si Kablan.

15. Facebook has become an integral part of modern social networking, connecting people, fostering communities, and facilitating communication across the globe.

16. The flowers are blooming in the garden.

17. Hindi ko kayang isipin na hindi kita kilalanin, kaya sana pwede ba kita makilala?

18. Walang anuman saad ng mayor.

19. A quien madruga, Dios le ayuda.

20. She loved to travel, and therefore spent most of her savings on trips.

21. Hindi ko alam kung pano ito sasabihin, hindi na ako magpapaligoyligoy pa, si Helena ay wala na.

22. Tuwing tag-init, maraming bata ang naglalaro ng saranggola.

23. Dahan dahan kaming nag lakad. Papapunta sa may.. Sigh.

24. Hindi ako komportable sa kanilang plano kaya ako ay tumututol.

25. Kucing di Indonesia sering dijadikan sebagai hewan peliharaan yang cocok untuk apartemen atau rumah kecil.

26. Les travailleurs indépendants travaillent souvent à leur propre compte.

27. Dapat pa nating higpitan ang seguridad ng establisimyento, mungkahi naman ng manager.

28. Kapag mayroong mga proyektong mahirap, pinagsisikapan ng mga manggagawa na matapos ito ng maayos.

29. Cuídate mucho en el camino, maneja con precaución y no te distraigas.

30. Las escuelas pueden ser administradas por el gobierno local, estatal o federal.

31. Binili ko ang sapatos dahil sa kanyang magandang disenyo, bagkus ito ay hindi gaanong komportable isuot.

32. Rawon adalah hidangan daging yang dimasak dengan bumbu rempah khas Jawa Timur yang berwarna hitam.

33. Ang tubig-ulan ay maaaring magdulot ng pagkakasakit kung hindi magiging maingat sa pag-inom nito.

34. Terima kasih banyak! - Thank you very much!

35. Isang araw, sa kanyang pagluluto hindi niya makita ang posporo.

36. Aaissh! biglang upo si Maico pagka-maktol.

37. Bago pa man maghatinggabi ay dumating nga ang prinsipe at lubos na nalugod ang nag-aalalang prinsesa.

38. Iba ang landas na kaniyang tinahak.

39. Omelettes are a popular choice for those following a low-carb or high-protein diet.

40. Medarbejdere kan skifte karriere når som helst i deres liv.

41. Elektroniske apparater kan hjælpe med at forbedre undervisning og læring i uddannelsessystemet.

42. Kumalas ako sa pagkakayakap niya sa akin.

43. Menciptakan keseimbangan antara pekerjaan, waktu luang, dan hubungan sosial membantu meningkatkan kebahagiaan.

44. Magkapareho ang kulay ng mga bag namin.

45. Eine klare Gewissensentscheidung kann uns helfen, unser Leben in Einklang mit unseren Überzeugungen zu leben.

46. "The more people I meet, the more I love my dog."

47. Hindi ako komportable sa mga taong nagpaplastikan dahil alam kong hindi nila ako tunay na kakampi.

48. La rotación de cultivos es una práctica agrícola que ayuda a mantener la salud del suelo.

49. Bumalik siya sa lugar ng aksidente at tulala sa nangyari.

50. Anong linya ho ang papuntang Monumento?

Recent Searches

ailmentsgodtbuenagoodeveningdumaanbumabagubuhinnahihilolegacyiskedyuldagatinatakescalemaystyrerpatawarinbossmatulogtaun-taonkaninacreationregulargoogletinanonganotipidkainitannyatv-showslordngunitpinangaralanggumigitinag-iisipplatformsstevebigyanpangkatnapakagagandapinalakingnakapagtaposdawnagbungaiintayinpagkakakawitsubalitmagulayawdiscoveredhalikalightssiguradopumupurinareklamonagbagoauthorpinakawalanpinagawaarmaelbatorawinabutankerbbasanananalongnatalosampaguitasundalonapakalusognapapahintonaroonsenadorkitang-kitamahalintumirakasingumanoumigtadnagtataelumayomalapitaniniindanyanitinatapatmatikmanhigpitanumagangbinigyangculprititsuraaniwaiterestilosstaywikaiwanannagpakunottalagangtumigilmedya-agwakumunotmarangaleditorilawnagpanggapinvitationeksenahetotolbituinjacesiemprebriefmuchassakupinshouldkatagalanthereforesetsvetobumabahaenfermedadeskinakailanganselanahantadanaytwitchsakimnag-emailrelievedkailanhimutoknamanmayabonghumihingalnaubostuladkinakabahannaglahogayunmanmaitimilanwondersingsinglawaynathanmotormissionbaguiomaglalakadoliviasittingmakangitisakabisignabuosarapmaihaharapnabalotpamilyaunangnakarinigpaki-basakumakantamakagawagulatibabawnakapilangmagagamitpangilsilyakamotenakinigmag-isangnoongaksiyonmatalimlalakefaktorer,brasolastipinalutopointkitmississippideclarebathalaperpektingnaggingteleviseddividesyonamoisinalangspeechdollarcheftheresharetomimaging