Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

7 sentences found for "lande"

1. Danmark eksporterer mange forskellige varer til lande over hele verden.

2. Danmark er kendt for at eksportere højteknologiske produkter og services til andre lande.

3. Dansk øl og spiritus eksporteres til mange lande rundt omkring i verden.

4. Danske møbler er kendt for deres høje kvalitet og eksporteres til mange lande.

5. Det er vigtigt at have gode handelsrelationer med andre lande, hvis man ønsker at eksportere succesfuldt.

6. Landet er et af de førende lande i verden inden for økologisk landbrug, og det er også et af de førende lande inden for vedvarende energi

7. Nogle lande og jurisdiktioner har lovgivning, der regulerer gambling for at beskytte spillerne og modvirke kriminalitet.

Random Sentences

1. Ang hinagpis ng isang ina ay dama sa kanyang bawat hikbi habang inaalala ang kanyang nawalang anak.

2. It is a common phenomenon experienced by individuals who feel a strong emotional pull towards parenthood and starting a family.

3. Gumawa si Tatay ng makukulay na saranggola para sa piyesta.

4. Electric cars have lower maintenance costs as they have fewer moving parts than gasoline-powered cars.

5. Setelah kelahiran, bayi akan dianggap sebagai anggota baru dalam keluarga dan masyarakat.

6. Napuno ng mga tao ang mga lansangan, kaya't ang lungsod ay hitik sa kasiyahan sa selebrasyon ng pista.

7. She has just left the office.

8. The photographer captured a series of images depicting the changing seasons.

9. Tengo tos seca. (I have a dry cough.)

10. Isang araw, kararating pa lang ng mag-asawa mula sa pagtitinda ng gulay, galing sa kuwarto ay lumabas si Aya at hiningi ang ipinagbiling prutas.

11. Napuyat na ako kakaantay sa yo.

12. Patients may need to follow a post-hospitalization care plan, which may include medications, rehabilitation, or lifestyle changes.

13. Tahimik ang buong bahay, waring walang tao sa loob.

14. The Machu Picchu ruins in Peru are a mystical wonder of the ancient Inca civilization.

15. At være bevidst om vores handlinger og beslutninger kan hjælpe os med at undgå at skade andre og os selv.

16. It's wise to compare different credit card options before choosing one.

17. Matumal ang bentahan ng bulaklak ngayong lockdown.

18. Aling lapis ang pinakamahaba?

19. El arte contemporáneo es una forma de arte que refleja las tendencias y estilos actuales.

20. Ang takip-silim ay isa sa pinakamagandang panahon upang maglakad-lakad sa gabi.

21. She has been knitting a sweater for her son.

22. Hindi na niya kaya ang mabibigat na gawain dahil mababa ang kanyang lakas.

23. Una de mis pasatiempos más antiguos es coleccionar monedas y billetes de diferentes países.

24. Advanced oscilloscopes offer mathematical functions, waveform analysis, and FFT (Fast Fourier Transform) capabilities.

25. Good Friday is the day when Jesus was crucified and died on the cross, an event that represents the ultimate sacrifice for the forgiveness of sins.

26. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

27. James Monroe, the fifth president of the United States, served from 1817 to 1825 and was known for his foreign policy doctrine that became known as the Monroe Doctrine.

28. Software er også en vigtig del af teknologi

29. Narinig kong sinabi nung dad niya.

30. Alam ko ang kabutihan ng iyong kalooban.

31. Tumalikod siya bigla saka pumasok sa kwarto niya.

32. Ang pabango ni Lolo ay nagbigay ng mabangong amoy sa kanyang kuwarto.

33. Nagdala si Butch ng laruan para sa bata.

34. Pagapang na bumaba ng hagdanan ang anak, sa pagsayad ng mga kamay nito sa lupa ay unti-unti itong nagbago.

35. I am planning my vacation.

36. Ang mga kasiyahan at salu-salo sa hapag-kainan ay nagdudulot ng kasiyahan sa bawat tahanan tuwing Chinese New Year.

37. Es común usar ropa abrigada, como abrigos, bufandas y guantes, en invierno.

38. Magandang ideya ang magbakasyon, datapwat kailangan ko munang mag-ipon.

39. Ang bilis natapos ng palabas sa sinehan.

40. May bumisita umano sa bahay nila kagabi ngunit hindi nila nakita kung sino.

41. Ang mga pook na mayabong na mga bulaklak ay karaniwang pinupuntahan ng mga turista.

42. Ikinalulungkot ko ang balitang yan.

43. Ang utang ay maaaring magdulot ng stress at anxiety kung hindi ito maayos na hinaharap.

44. Lontong sayur adalah hidangan nasi lontong dengan sayuran dan bumbu yang khas Indonesia.

45. Ako muna sabi, e, giit ni Ogor.

46. LeBron James continues to inspire and influence future generations of athletes with his remarkable skills, leadership, and commitment to making a difference both on and off the court.

47. He won his fourth NBA championship in 2020, leading the Lakers to victory in the NBA Bubble.

48. Elektronikken i en bil kan hjælpe med at forbedre kørsel og sikkerhed.

49. Wala namang ibang tao pedeng makausap eh.

50. Las personas pobres a menudo carecen de recursos para protegerse de desastres naturales y crisis.

Similar Words

Landet

Recent Searches

linawlandewasakpsssjocelyntambayanmensajesyunatamalakingnaalislearnmagtatanimnahulistudiedpartesapatosnapagtantoresponsibleleftandynagpapaigibhinagpisbetweenskills,oncepaboritoasomaglinislansangankagandalobbymagtatagalofferkutodnaglalambingumakbaysakaymanuscriptwalngpopularizeilangkablanipinadalasemillascalciumeuphoriciniwanpangingimicellphonereachartistsnagtitinginantarcilamagdugtongsuriinmakauwikasingtigasricodrayberdontmarchprocesopootbugtongdollyulamfeedback,bilinmisasweetipagamotradiotumalikodstarted:endelignagpakitanogensindebilhanunibersidadnakaangatbarmetodedownbehalfcandetectedinalisstudentproducirkailangannaiinggitcompletepracticesinternagitarasettingmessagetopicuminomnaggingactiongratificante,lumalakibubongdadalhinbopolsunti-untingpapanhiknakakabangonmamanhikanitinindignakakamitsimbahanlumiwagglobalisasyonpunong-punouulaminpamahalaankumikinigmatapobrengpinatutunayanbefolkningen,nagtalagatabakamustatrafficinitcomplexyeahdalawangclassmatetumatawadneedssilbingyesdahiljingjingkusineroiloilopioneermensahegawinsakimmasgamitbintanabunutaneleksyondebatessmilejobanghelpublicationcomputere,campaignscupidincludemasaholisipbigaskarunungankayang-kayangsagasaantotoongpinag-aralancultivationvideosmachinespinauwinaiiritangpaaralanmataashealthiertinderatayolegislationtomorrownaiisipmedikalmatarayvotesbakuransunud-sunodhindipinakamatapatbinuksanamparotokyoipagmalaakivegasfarmnagkalapitmaghilamosflyvemaskineriniuwihappenedmahabaalbularyosumapit