Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

5 sentences found for "developed"

1. Einstein developed the theory of special relativity while working as a patent clerk in Bern, Switzerland.

2. He developed the theory of relativity, which revolutionized our understanding of space, time, and gravity.

3. He was a master of several different styles, including Wing Chun, boxing, and fencing, and he developed his own style, Jeet Kune Do, which emphasized fluidity and adaptability

4. That is why new and unconventional sources of energy like nuclear and solar energy need to be developed

5. The first mobile phone was developed in 1983, and since then, the technology has continued to improve

Random Sentences

1. Basketball players are known for their athletic abilities and physical prowess, as well as their teamwork and sportsmanship.

2. Ang dating kawawang usa a naging isang napakagandang diwata subalit hindi na rin natago ang mga sugat nito.

3. The Cybertruck, an upcoming electric pickup truck by Tesla, has garnered significant attention for its futuristic design and capabilities.

4. Ang pagbabayad ng utang ay magpapakita ng pagiging responsable sa pagpapalago ng financial status.

5. Nous allons nous marier à l'église.

6. Ang alon sa karagatan ay malakas ngayon dahil sa bagyong dumaan.

7. The foundation's charitable efforts have improved the lives of many underprivileged children.

8. I can't believe how hard it's raining outside - it's really raining cats and dogs!

9. Sweetness can be a source of comfort and pleasure for many people.

10. Bakit sila nandito tanong ko sa sarili ko.

11. Sa takip-silim, nagiging malamig ang panahon at nakakapagbigay ng komporta sa mga tao.

12. The bag of groceries was too hefty for the elderly woman to carry on her own.

13. Nakakatakot ang gagamba na kanyang nakita.

14. Ngunit hindi napigilan si Magda ng kanyang mga anak.

15. Ang pag-ulan ay nagpawi ng init at tuyot sa lupa.

16. Le chien est très mignon.

17. He appointed three Supreme Court justices during his presidency, shaping the ideological balance of the court.

18. Bakit niya gustong magpahaba ng buhok?

19. Magpapabakuna ako bukas.

20. Sa dapit-hapon, masarap mag-stroll sa mga kalye at maghanap ng masarap na kainan.

21. Einstein was an accomplished violinist and often played music with friends and colleagues.

22. Twitter is known for its role in breaking news and providing a platform for public discussions and debates.

23. Gaano katagal niyang hinintay ang pakete?

24. Lumapit sakin si Kenji tapos naka smile siya.

25. Les maladies infectieuses telles que le VIH/SIDA, la tuberculose et la grippe peuvent être prévenues grâce à une bonne hygiène et des vaccinations.

26. Bawal maglaro ng bola sa loob ng bahay dahil ito ay nakakasira ng gamit.

27. Ang laki ng pinanalunan nila sa lotto.

28. Ang sugal ay maaaring magdulot ng pagkakaroon ng mga utang at pinansyal na problema.

29. Our relationship is going strong, and so far so good.

30. Kung hindi siya maramot, baka mas marami ang natulungan niya.

31. Es importante tener amigos que nos apoyen y nos escuchen.

32. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

33. Los padres sienten un inmenso amor y conexión instantánea con su bebé desde el momento del nacimiento.

34. The Taj Mahal in India is a magnificent wonder of architecture.

35. Sayang, jangan lupa untuk makan malam nanti. (Dear, don't forget to have dinner tonight.)

36. Sa loob ng isang saglit, hindi niya maulit na salatin ang biyak na pisngi.

37. Gracias por escucharme cuando más lo necesitaba.

38. La internet nos permite comunicarnos con personas de todo el mundo a través de correo electrónico, redes sociales y otros medios.

39. Ang ilalim ng kanyang payong ay nagsilbing lilim mula sa malakas na sikat ng araw.

40. Sadyang mahirap ang pag-aaral ng calculus.

41. I've been driving on this road for an hour, and so far so good.

42. Sweetness can also be found in natural sweeteners, such as honey and maple syrup.

43. One of the most significant impacts of television has been on the way that people consume media

44. She has written five books.

45. Doa juga bisa dianggap sebagai bentuk ungkapan syukur atas nikmat dan karunia yang diberikan Tuhan.

46. Puwede ba bumili ng tiket dito?

47. While there are concerns about the effects of television on society, the medium continues to evolve and improve, and it is likely to remain an important part of our daily lives for many years to come This is just a brief overview of the 1000 paragraphs about television, as the information provided would be too long to fit here

48. He tried to keep it a secret, but eventually he spilled the beans.

49. I have been working on this project for a week.

50. Limitar el consumo de alimentos procesados y azúcares añadidos puede mejorar la salud en general.

Recent Searches

developedpancitkanya-kanyangdiyanbumubulaexhaustioniosmandukotmagtataasdahilnagdaanhanggangcountrykasalukuyanmalapitannakamitpanibagongnakabanggaresumensobrangnakatitiggiraybungatopic,ideologiesresponsiblenagbungatinulunganmatutuwanapawimakeculpritisamakaarawanmaghintaykisapmatatrabajarreducedmabalikimulattanggalinnagisingtumatawagballnoonnagpapaniwalamakapasoktalinoantibioticsleytenavigationpaghaliktulalaginagawatakbosalubongtinikpangitmaulinigannunglaborEdadcontinuesmakakasahodmakasahodiconconditionlumayokalakingwaringbanalkitkatandaanmagandametodiskpinagkakaguluhanipinaalamfurthernapabayaankambingclientepananghalianomfattendenetomichaelgitanasmaghahandanaramdamliablepasensiyahigittiyakmagpalagonabasagalitcomplexnapasigawmangeumibigiconickulay-lumotmalimitdisentengunitparoroonaamparoseriousmakikitadiamondiyongnabuosinumantanggapinpang-aasarsamantalangdependcountriesbilhinumabotpagka-maktolmagbigayanitaykadalaskinagalitangumigitinahawakanlashinihilingkasijulietmagkanopunung-kahoyrespectnaiilangingatanpogitreatsmanmalambingsonmoderneindianagtalunanniligawanmagtatagaldisensyokerbhimutokbulaklakpromisebastacynthiainuulammaglutomemorialgassinoiniinomcalidadnakangitiisinaraabangannilayuanparecitizennaghihirapkawalanhumahangamahalinespadabrasopublished,legitimate,improvementbatok---kaylamigrequierenpinagalitanpangnangnapadungawpagbisitadidingnakapagproposenanakawantrycyclekantaisulatmag-ingatmasaganangyorkhappiernapakatalinotumayooffentligcesbeginningmagkasintahanlalongnakilalamamahalinnoong