Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

5 sentences found for "establish"

1. Einstein's work also helped to establish the field of quantum mechanics.

2. He was also known for his charismatic stage presence and unique vocal style, which helped to establish him as one of the most iconic figures in American music

3. I find that breaking the ice early in a job interview helps to put me at ease and establish a rapport with the interviewer.

4. Shows like I Love Lucy and The Honeymooners helped to establish television as a medium for entertainment

5. These songs helped to establish Presley as one of the most popular and influential musicians of his time, and they continue to be popular today

Random Sentences

1. Hello love birds! bati ko sa kanila nang makalapit ako.

2. Uno de los festivales de música más importantes de España es el Festival de San Sebastián, que se celebra en septiembre y cuenta con la participación de artistas de renombre internacional

3. She was excited about the free trial, but I warned her that there's no such thing as a free lunch.

4. She helps her mother in the kitchen.

5. Unti-unting lumapad yung ngiti niya.

6. Zachary Taylor, the twelfth president of the United States, served from 1849 to 1850 and died while in office.

7. Fødslen kan tage lang tid, og det er vigtigt at have tålmodighed og støtte.

8. For eksempel kan vi nu få adgang til tusindvis af film og tv-shows på vores telefoner og computere, og vi kan styre vores hjem med en app på vores telefon

9. Saan pa kundi sa aking pitaka.

10. Sweetness is a sensation associated with the taste of sugar and other natural and artificial sweeteners.

11. Después de haber viajado por todo el mundo, regresé a mi ciudad natal.

12. Omelettes are a popular choice for those following a low-carb or high-protein diet.

13. Las pitones y las boas constrictoras son serpientes que envuelven a sus presas y las aprietan hasta asfixiarlas.

14. Nais nating makamit ang ating mga pangarap upang magkaroon tayo ng mas magandang buhay.

15. We have visited the museum twice.

16. Ayon sa mga ulat, may paparating umano na bagyo sa susunod na linggo.

17. Camarón que se duerme, se lo lleva la corriente. - You snooze, you lose.

18. Trump was known for his background in real estate and his role as a television personality on the show "The Apprentice."

19. Forgiveness doesn't mean forgetting or condoning the actions of others; it's about freeing ourselves from the negative emotions that hold us captive.

20. Mabait ang mga kapitbahay niya.

21. Nakita ng mga ibon si Paniki at tinanong siya kung bakit siya asa kanilang kampo samantalang isa naman daw siyang mabangis na hayop.

22. Nag-aalalang sambit ng matanda.

23. Nasanay na siyang salatin ang dingding para maghanap ng switch ng ilaw.

24. La tos puede ser un síntoma de COVID-19.

25. Kailangan nating magpasya ng may katwiran at hustisya, datapapwat ay hindi palaging tama ang ating mga desisyon.

26. You reap what you sow.

27. Ang karagatan ay malalim at malawak na lugar na puno ng buhay-alon.

28. Gusto kong manood ng mga pambatang palabas.

29. ¿Cómo te va?

30. Mas magaling siya kaysa sa kanya.

31. Las escuelas tienen una política de tolerancia cero para el acoso escolar.

32. Amazon's customer service is known for being responsive and helpful.

33. A caballo regalado no se le mira el dentado.

34. Para el Día de los Enamorados, mi pareja y yo nos fuimos de viaje a un lugar romántico.

35. Different types of work require different skills, education, and training.

36. La salsa de chile es una de mis favoritas, me gusta el sabor picante.

37.

38. He is not having a conversation with his friend now.

39. Humingi ng tulong ang magsasaka sa albularyo dahil naniniwala siyang may kulam sa kanyang hayop.

40. Hindi nakagalaw si Matesa.

41. He admires his friend's musical talent and creativity.

42. The culprit who stole the purse was caught on camera and identified by the victim.

43. I accidentally spilled the beans about the surprise trip, but she was still excited.

44. Kung kasamaan pa rin ang nasa iyong pagiisip, sanay huwag kanang makatayo.

45. Hay muchas formas de arte, como la pintura, la escultura, la danza y la música.

46. Inakalang nalimutan siya ng kaibigan, pero nagulat siya sa sorpresa nito.

47. Uminom siya ng maraming tubig upang iwasan ang bungang-araw.

48. Taos puso silang humingi ng tawad.

49. The celebration of Christmas has become a secular holiday in many cultures, with non-religious customs and traditions also associated with the holiday.

50. Sa pagpanhik ng matanda sa burol ay bumuhos ang malakas na ulan, at yumanig ang lupa.

Similar Words

established

Recent Searches

establishtrabajarnakabulagtanghawakanhinagismatunawnakataposmedisinamakisuyomagandajosiepagkamulatbingomaskadventtuvosanhojasmabatongstorymagdoorbellrabeitongngumiwilosselluugod-ugoddivisionpagkainisayandontdiyosabalanagbasahitiknalulungkotpara-paranggearlumbayeithercharitabledawinternetjacemalumbaytshirtmakamitkingsimulasabienvironmentmagbigayanhatinggabijacky---unfortunatelytatayoroofstockwriting,paalamnagingreviewshiftfacebookcaracterizanagliliwanagconsideredsasamahanipinamilina-suwayenhedernakaririmarimeconomysiguroitinaaskatawangligayawhilepamanhikannalalabingnakabibingingamericanasunogearntumindigbusiness:samfundmalalakiumingitwednesdaysmallbinigaykumustarobinhoodsufferleokumakainhinogfrogartistssambitinternaappscientistnapilievilsorefulllaborsofahimselfmapahamakparoloftenlargelalagayunmanlaronagsusulatsonidosampungdyipnibigasataauditnagcurvekasaganaannagsinebukodpagkaraapagtatanongtonightmalapalasyobumalikmagkakailanagtatanghaliandireksyonbilanginbiyassumayagoodeveningjokehearguerrerodependingdeclarebehalfsidolapitanpalaisipanfreedomsmalungkotproducerermendiolamahalinnasaktanmovingpamamahingakatolikonauliniganmisafollowing,mukaskills,pisolumalakimuchosbumilissikre,pagkasabimakikiligotradisyonmamahalintoyelectedmagsalitaspeedhalu-halomagamotnamumulaiguhitencounternasabarung-barongsiembramagpagalingabrilmagpalagoexpertparangpaghihingalostaylaganaphagikgikriegapowerlilipadpinagmamalakinaghilamosfireworkssimbaha